BLASTX nr result
ID: Ophiopogon24_contig00029239
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00029239 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020095877.1| putative pentatricopeptide repeat-containing... 73 4e-12 ref|XP_008790235.1| PREDICTED: putative pentatricopeptide repeat... 71 2e-11 gb|OAY72532.1| putative pentatricopeptide repeat-containing prot... 70 2e-11 ref|XP_020257798.1| putative pentatricopeptide repeat-containing... 65 2e-09 ref|XP_010936130.1| PREDICTED: putative pentatricopeptide repeat... 65 2e-09 gb|PKA58311.1| Putative pentatricopeptide repeat-containing prot... 64 3e-09 gb|ONK75973.1| uncharacterized protein A4U43_C03F22500 [Asparagu... 64 3e-09 gb|PAN20579.1| hypothetical protein PAHAL_C03650 [Panicum hallii] 63 8e-09 gb|KQL16145.1| hypothetical protein SETIT_024660mg, partial [Set... 63 1e-08 ref|XP_012699838.1| putative pentatricopeptide repeat-containing... 63 1e-08 ref|XP_020185681.1| putative pentatricopeptide repeat-containing... 62 2e-08 gb|ONM59770.1| Putative pentatricopeptide repeat-containing prot... 58 3e-08 dbj|BAH93045.1| Os05g0275100, partial [Oryza sativa Japonica Group] 60 4e-08 gb|AAT85126.1| hypothetical protein [Oryza sativa Japonica Group] 60 1e-07 gb|EEC78894.1| hypothetical protein OsI_19266 [Oryza sativa Indi... 60 1e-07 ref|XP_020700690.1| putative pentatricopeptide repeat-containing... 59 3e-07 gb|ONM59774.1| Putative pentatricopeptide repeat-containing prot... 58 4e-07 gb|ONM59772.1| Putative pentatricopeptide repeat-containing prot... 58 5e-07 gb|ONM59775.1| Putative pentatricopeptide repeat-containing prot... 58 5e-07 gb|OEL36077.1| putative pentatricopeptide repeat-containing prot... 58 6e-07 >ref|XP_020095877.1| putative pentatricopeptide repeat-containing protein At1g19290 [Ananas comosus] ref|XP_020095887.1| putative pentatricopeptide repeat-containing protein At1g19290 [Ananas comosus] ref|XP_020095894.1| putative pentatricopeptide repeat-containing protein At1g19290 [Ananas comosus] ref|XP_020095902.1| putative pentatricopeptide repeat-containing protein At1g19290 [Ananas comosus] ref|XP_020095911.1| putative pentatricopeptide repeat-containing protein At1g19290 [Ananas comosus] ref|XP_020095920.1| putative pentatricopeptide repeat-containing protein At1g19290 [Ananas comosus] Length = 949 Score = 72.8 bits (177), Expect = 4e-12 Identities = 34/57 (59%), Positives = 40/57 (70%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFPEVGLREPLGSVENGIGKEVEH 173 PNYVTY TL+QGYIRCGNL+ VSKL E MHIRGLFP + + E K+V+H Sbjct: 881 PNYVTYWTLIQGYIRCGNLKQVSKLYEEMHIRGLFPAFPFKGNIYQAEPAAKKQVQH 937 >ref|XP_008790235.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Phoenix dactylifera] Length = 952 Score = 70.9 bits (172), Expect = 2e-11 Identities = 33/69 (47%), Positives = 44/69 (63%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFPEVGLREPLGSVENGIGKEVEHTIG 182 PNYVTY TLVQGYIRC ++ +SKL E MHIRGLFP V + +G E K ++H Sbjct: 884 PNYVTYSTLVQGYIRCMDMHQISKLYEEMHIRGLFPAVAFKGNMGPAEPMAVKGIKHGTI 943 Query: 183 KMTAYVDCY 209 ++ ++ Y Sbjct: 944 NLSEHIHAY 952 >gb|OAY72532.1| putative pentatricopeptide repeat-containing protein, partial [Ananas comosus] Length = 366 Score = 70.1 bits (170), Expect = 2e-11 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFPEVGLREPLGSV 143 PNYVTY TL+QGYIRCGNL+ VSKL E MHIRGLFP + P SV Sbjct: 299 PNYVTYWTLIQGYIRCGNLKQVSKLYEEMHIRGLFPAFPFKGPSPSV 345 >ref|XP_020257798.1| putative pentatricopeptide repeat-containing protein At1g19290, partial [Asparagus officinalis] Length = 912 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFPEVGL 122 PNYVTY TLV YIRC NLQ VS+L + MHIRGL PEVGL Sbjct: 873 PNYVTYSTLVHSYIRCRNLQQVSRLYDQMHIRGLLPEVGL 912 >ref|XP_010936130.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Elaeis guineensis] ref|XP_010936131.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Elaeis guineensis] Length = 955 Score = 65.1 bits (157), Expect = 2e-09 Identities = 32/69 (46%), Positives = 41/69 (59%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFPEVGLREPLGSVENGIGKEVEHTIG 182 PNYVTY TLV YIRC ++ +SKL E MHIRGLFP V + +G E K +H Sbjct: 887 PNYVTYSTLVWRYIRCMDMHQISKLYEEMHIRGLFPAVAFKGNMGPAEPIAVKGTKHDTV 946 Query: 183 KMTAYVDCY 209 K+ ++ Y Sbjct: 947 KLFEHIHAY 955 >gb|PKA58311.1| Putative pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 943 Score = 64.3 bits (155), Expect = 3e-09 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFPEVGLREPLGS 140 PN+VTYCTLV G+IRCG+++ VSKL E MHIRGL P R GS Sbjct: 875 PNFVTYCTLVHGHIRCGDMRQVSKLYEEMHIRGLLPPADYRGTSGS 920 >gb|ONK75973.1| uncharacterized protein A4U43_C03F22500 [Asparagus officinalis] Length = 1022 Score = 64.3 bits (155), Expect = 3e-09 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFPEVGL 122 PNYVTY TLV YIRC NLQ VS+L + MHIRGL PEVG+ Sbjct: 873 PNYVTYSTLVHSYIRCRNLQQVSRLYDQMHIRGLLPEVGI 912 >gb|PAN20579.1| hypothetical protein PAHAL_C03650 [Panicum hallii] Length = 597 Score = 63.2 bits (152), Expect = 8e-09 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 5/55 (9%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFP-----EVGLREPLGSVENG 152 PNYVTY TL+QGYIRCGN++ +SKL + MHIRGL P +V P+ +NG Sbjct: 534 PNYVTYWTLIQGYIRCGNMKEISKLYDEMHIRGLLPAYVAGDVKQASPVERNQNG 588 >gb|KQL16145.1| hypothetical protein SETIT_024660mg, partial [Setaria italica] Length = 728 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFP 110 PNYVTY TL+QGYIRCGN++ +SKL + MHIRGL P Sbjct: 687 PNYVTYWTLIQGYIRCGNMKEISKLYDEMHIRGLLP 722 >ref|XP_012699838.1| putative pentatricopeptide repeat-containing protein At1g19290 [Setaria italica] ref|XP_012699839.1| putative pentatricopeptide repeat-containing protein At1g19290 [Setaria italica] ref|XP_012699840.1| putative pentatricopeptide repeat-containing protein At1g19290 [Setaria italica] ref|XP_012699841.1| putative pentatricopeptide repeat-containing protein At1g19290 [Setaria italica] ref|XP_022680481.1| putative pentatricopeptide repeat-containing protein At1g19290 [Setaria italica] ref|XP_022680482.1| putative pentatricopeptide repeat-containing protein At1g19290 [Setaria italica] Length = 933 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFP 110 PNYVTY TL+QGYIRCGN++ +SKL + MHIRGL P Sbjct: 870 PNYVTYWTLIQGYIRCGNMKEISKLYDEMHIRGLLP 905 >ref|XP_020185681.1| putative pentatricopeptide repeat-containing protein At1g19290 [Aegilops tauschii subsp. tauschii] Length = 934 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFPEVG 119 PNYVTY TL+QGY+RCGN++ +SKL MHIRGL P G Sbjct: 873 PNYVTYWTLIQGYVRCGNMKEISKLYNEMHIRGLLPANG 911 >gb|ONM59770.1| Putative pentatricopeptide repeat-containing protein [Zea mays] Length = 108 Score = 58.2 bits (139), Expect = 3e-08 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFP 110 PNYVTY TL+QGY+RCGN+ +SK+ + MHI GL P Sbjct: 43 PNYVTYWTLIQGYVRCGNMIEISKIYDKMHIHGLLP 78 >dbj|BAH93045.1| Os05g0275100, partial [Oryza sativa Japonica Group] Length = 213 Score = 60.1 bits (144), Expect = 4e-08 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFP 110 PNY+TYCTL+ GYI+ GN++ +SKL + MHIRGL P Sbjct: 147 PNYITYCTLIHGYIKSGNMEEISKLYDEMHIRGLLP 182 >gb|AAT85126.1| hypothetical protein [Oryza sativa Japonica Group] Length = 920 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFP 110 PNY+TYCTL+ GYI+ GN++ +SKL + MHIRGL P Sbjct: 854 PNYITYCTLIHGYIKSGNMEEISKLYDEMHIRGLLP 889 >gb|EEC78894.1| hypothetical protein OsI_19266 [Oryza sativa Indica Group] gb|EEE63070.1| hypothetical protein OsJ_17878 [Oryza sativa Japonica Group] dbj|BAS93110.1| Os05g0275100 [Oryza sativa Japonica Group] Length = 939 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFP 110 PNY+TYCTL+ GYI+ GN++ +SKL + MHIRGL P Sbjct: 873 PNYITYCTLIHGYIKSGNMEEISKLYDEMHIRGLLP 908 >ref|XP_020700690.1| putative pentatricopeptide repeat-containing protein At1g19290 [Dendrobium catenatum] ref|XP_020700691.1| putative pentatricopeptide repeat-containing protein At1g19290 [Dendrobium catenatum] ref|XP_020700692.1| putative pentatricopeptide repeat-containing protein At1g19290 [Dendrobium catenatum] ref|XP_020700693.1| putative pentatricopeptide repeat-containing protein At1g19290 [Dendrobium catenatum] gb|PKU77225.1| Putative pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 958 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFPEVGLREPLGS 140 PN+VTYCTLV GY R G+L VSKL E MH RGLFP + L S Sbjct: 892 PNFVTYCTLVYGYKRSGDLSQVSKLYEEMHFRGLFPTFNCKGTLDS 937 >gb|ONM59774.1| Putative pentatricopeptide repeat-containing protein [Zea mays] Length = 484 Score = 58.2 bits (139), Expect = 4e-07 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFP 110 PNYVTY TL+QGY+RCGN+ +SK+ + MHI GL P Sbjct: 419 PNYVTYWTLIQGYVRCGNMIEISKIYDKMHIHGLLP 454 >gb|ONM59772.1| Putative pentatricopeptide repeat-containing protein [Zea mays] gb|ONM59776.1| Putative pentatricopeptide repeat-containing protein [Zea mays] gb|ONM59777.1| Putative pentatricopeptide repeat-containing protein [Zea mays] gb|ONM59782.1| Putative pentatricopeptide repeat-containing protein [Zea mays] gb|ONM59784.1| Putative pentatricopeptide repeat-containing protein [Zea mays] gb|ONM59786.1| Putative pentatricopeptide repeat-containing protein [Zea mays] gb|ONM59788.1| Putative pentatricopeptide repeat-containing protein [Zea mays] Length = 765 Score = 58.2 bits (139), Expect = 5e-07 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFP 110 PNYVTY TL+QGY+RCGN+ +SK+ + MHI GL P Sbjct: 700 PNYVTYWTLIQGYVRCGNMIEISKIYDKMHIHGLLP 735 >gb|ONM59775.1| Putative pentatricopeptide repeat-containing protein [Zea mays] gb|ONM59778.1| Putative pentatricopeptide repeat-containing protein [Zea mays] gb|ONM59780.1| Putative pentatricopeptide repeat-containing protein [Zea mays] gb|ONM59781.1| Putative pentatricopeptide repeat-containing protein [Zea mays] gb|ONM59783.1| Putative pentatricopeptide repeat-containing protein [Zea mays] gb|ONM59789.1| Putative pentatricopeptide repeat-containing protein [Zea mays] gb|ONM59790.1| Putative pentatricopeptide repeat-containing protein [Zea mays] Length = 939 Score = 58.2 bits (139), Expect = 5e-07 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFP 110 PNYVTY TL+QGY+RCGN+ +SK+ + MHI GL P Sbjct: 874 PNYVTYWTLIQGYVRCGNMIEISKIYDKMHIHGLLP 909 >gb|OEL36077.1| putative pentatricopeptide repeat-containing protein [Dichanthelium oligosanthes] Length = 927 Score = 57.8 bits (138), Expect = 6e-07 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 3 PNYVTYCTLVQGYIRCGNLQHVSKLNEAMHIRGLFP 110 PNYVTY TL+QGYIR GN++ +SKL MHIRGL P Sbjct: 866 PNYVTYWTLIQGYIRSGNMKEISKLYAEMHIRGLLP 901