BLASTX nr result
ID: Ophiopogon24_contig00028620
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00028620 (342 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00297.1| unnamed protein product [Coffea canephora] 85 8e-17 ref|XP_010096350.1| SNF1-related protein kinase regulatory subun... 85 8e-17 ref|XP_021664938.1| SNF1-related protein kinase regulatory subun... 84 1e-16 ref|XP_021664936.1| SNF1-related protein kinase regulatory subun... 84 2e-16 ref|XP_021664935.1| SNF1-related protein kinase regulatory subun... 84 2e-16 ref|XP_010934735.1| PREDICTED: SNF1-related protein kinase regul... 83 3e-16 ref|XP_015894920.1| PREDICTED: SNF1-related protein kinase regul... 82 3e-16 ref|XP_008813531.1| PREDICTED: SNF1-related protein kinase regul... 82 5e-16 ref|XP_012855218.1| PREDICTED: SNF1-related protein kinase regul... 82 5e-16 gb|OWM75967.1| hypothetical protein CDL15_Pgr009612 [Punica gran... 82 5e-16 gb|EOY02037.1| Cystathionine beta-synthase protein isoform 2 [Th... 81 7e-16 ref|XP_010242383.1| PREDICTED: SNF1-related protein kinase regul... 82 7e-16 gb|KVH96142.1| Cystathionine beta-synthase, core [Cynara cardunc... 82 8e-16 ref|XP_021624446.1| SNF1-related protein kinase regulatory subun... 82 1e-15 gb|EPS57875.1| hypothetical protein M569_16941, partial [Genlise... 81 1e-15 gb|KZV38822.1| hypothetical protein F511_21824 [Dorcoceras hygro... 81 1e-15 ref|XP_021299605.1| SNF1-related protein kinase regulatory subun... 81 1e-15 gb|EOY02036.1| Cystathionine beta-synthase protein isoform 1 [Th... 81 1e-15 ref|XP_022850630.1| SNF1-related protein kinase regulatory subun... 81 2e-15 ref|XP_009410765.1| PREDICTED: SNF1-related protein kinase regul... 80 2e-15 >emb|CDP00297.1| unnamed protein product [Coffea canephora] Length = 440 Score = 84.7 bits (208), Expect = 8e-17 Identities = 38/54 (70%), Positives = 46/54 (85%) Frame = -1 Query: 162 KKSVS*DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 +K ++ D PTA D LGEDFYK++LQEEPFK TTVKS++KSYRWAPF+PV DSS Sbjct: 169 EKGMAKDAPTAADKLGEDFYKVILQEEPFKSTTVKSILKSYRWAPFIPVATDSS 222 >ref|XP_010096350.1| SNF1-related protein kinase regulatory subunit gamma-1-like [Morus notabilis] gb|EXB63825.1| SNF1-related protein kinase regulatory subunit gamma-1-like protein [Morus notabilis] Length = 443 Score = 84.7 bits (208), Expect = 8e-17 Identities = 38/53 (71%), Positives = 44/53 (83%) Frame = -1 Query: 159 KSVS*DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 K + D PTA D LG+DFYK+LLQEEPFK TTV S++KSYRWAPF+PV PDSS Sbjct: 173 KGMGKDAPTAADKLGDDFYKVLLQEEPFKSTTVSSILKSYRWAPFIPVAPDSS 225 >ref|XP_021664938.1| SNF1-related protein kinase regulatory subunit gamma-1-like isoform X3 [Hevea brasiliensis] Length = 356 Score = 84.0 bits (206), Expect = 1e-16 Identities = 38/53 (71%), Positives = 44/53 (83%) Frame = -1 Query: 159 KSVS*DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 K + D PTA D LG+DFYK++LQEEPFK TTVKS++KSYRWAPFLPV DSS Sbjct: 176 KGLGKDAPTAADNLGQDFYKVILQEEPFKSTTVKSIIKSYRWAPFLPVATDSS 228 >ref|XP_021664936.1| SNF1-related protein kinase regulatory subunit gamma-1-like isoform X2 [Hevea brasiliensis] Length = 443 Score = 84.0 bits (206), Expect = 2e-16 Identities = 38/53 (71%), Positives = 44/53 (83%) Frame = -1 Query: 159 KSVS*DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 K + D PTA D LG+DFYK++LQEEPFK TTVKS++KSYRWAPFLPV DSS Sbjct: 173 KGLGKDAPTAADNLGQDFYKVILQEEPFKSTTVKSIIKSYRWAPFLPVATDSS 225 >ref|XP_021664935.1| SNF1-related protein kinase regulatory subunit gamma-1-like isoform X1 [Hevea brasiliensis] Length = 446 Score = 84.0 bits (206), Expect = 2e-16 Identities = 38/53 (71%), Positives = 44/53 (83%) Frame = -1 Query: 159 KSVS*DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 K + D PTA D LG+DFYK++LQEEPFK TTVKS++KSYRWAPFLPV DSS Sbjct: 176 KGLGKDAPTAADNLGQDFYKVILQEEPFKSTTVKSIIKSYRWAPFLPVATDSS 228 >ref|XP_010934735.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Elaeis guineensis] Length = 435 Score = 83.2 bits (204), Expect = 3e-16 Identities = 40/54 (74%), Positives = 45/54 (83%) Frame = -1 Query: 162 KKSVS*DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 +K + D PTA D LGEDFYK+LLQEEPFK TTVKS+V+SYRWAPFLPV DSS Sbjct: 169 EKGIWKDAPTAADKLGEDFYKVLLQEEPFKSTTVKSIVQSYRWAPFLPVGLDSS 222 >ref|XP_015894920.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Ziziphus jujuba] Length = 277 Score = 81.6 bits (200), Expect = 3e-16 Identities = 36/53 (67%), Positives = 44/53 (83%) Frame = -1 Query: 159 KSVS*DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 K + D PTA D LG+DFYK++LQ+EPFK TTV S++KSYRWAPF+PV PDSS Sbjct: 172 KGMGKDAPTAADNLGDDFYKVILQDEPFKSTTVGSILKSYRWAPFIPVAPDSS 224 >ref|XP_008813531.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Phoenix dactylifera] Length = 435 Score = 82.4 bits (202), Expect = 5e-16 Identities = 39/54 (72%), Positives = 45/54 (83%) Frame = -1 Query: 162 KKSVS*DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 +K + D PTA D LGEDFYK+LLQEEPFK T+VKS+V+SYRWAPFLPV DSS Sbjct: 169 EKGIGKDAPTAADRLGEDFYKVLLQEEPFKSTSVKSIVQSYRWAPFLPVGLDSS 222 >ref|XP_012855218.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Erythranthe guttata] Length = 445 Score = 82.4 bits (202), Expect = 5e-16 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = -1 Query: 144 DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 D PTA D LGEDFYK++L EEPFK TTV S+VKSYRWAPF+PV PDSS Sbjct: 177 DAPTAADKLGEDFYKVILHEEPFKSTTVGSIVKSYRWAPFVPVAPDSS 224 >gb|OWM75967.1| hypothetical protein CDL15_Pgr009612 [Punica granatum] gb|PKI36860.1| hypothetical protein CRG98_042809 [Punica granatum] Length = 448 Score = 82.4 bits (202), Expect = 5e-16 Identities = 37/54 (68%), Positives = 44/54 (81%) Frame = -1 Query: 162 KKSVS*DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 +K D PTA D LGEDFYK++LQEEPFK TTVKS++KSYRWAPF+PV +SS Sbjct: 177 EKGAGQDAPTAADNLGEDFYKVILQEEPFKSTTVKSIIKSYRWAPFVPVAEESS 230 >gb|EOY02037.1| Cystathionine beta-synthase protein isoform 2 [Theobroma cacao] Length = 324 Score = 81.3 bits (199), Expect = 7e-16 Identities = 37/53 (69%), Positives = 44/53 (83%) Frame = -1 Query: 159 KSVS*DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 + V D P+A D LGEDFYK++LQEEPFK TTV+S+VKSYRWAPF+PV DSS Sbjct: 203 QGVGKDAPSAADNLGEDFYKVILQEEPFKSTTVRSIVKSYRWAPFVPVATDSS 255 >ref|XP_010242383.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Nelumbo nucifera] Length = 444 Score = 82.0 bits (201), Expect = 7e-16 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = -1 Query: 144 DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 D PTA D LGEDFYK++LQEEPFK TTV+S+VKS+RWAPFLPV DSS Sbjct: 178 DAPTAADSLGEDFYKVILQEEPFKSTTVRSIVKSFRWAPFLPVSTDSS 225 >gb|KVH96142.1| Cystathionine beta-synthase, core [Cynara cardunculus var. scolymus] Length = 451 Score = 82.0 bits (201), Expect = 8e-16 Identities = 37/54 (68%), Positives = 44/54 (81%) Frame = -1 Query: 162 KKSVS*DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 +K + D PTA D LGEDFYK++LQEEPFK T VKS+VKSYRWAP++PV DSS Sbjct: 177 EKGMGKDAPTAADELGEDFYKVILQEEPFKSTQVKSIVKSYRWAPYIPVTTDSS 230 >ref|XP_021624446.1| SNF1-related protein kinase regulatory subunit gamma-1-like [Manihot esculenta] gb|OAY61445.1| hypothetical protein MANES_01G189100 [Manihot esculenta] Length = 442 Score = 81.6 bits (200), Expect = 1e-15 Identities = 37/53 (69%), Positives = 44/53 (83%) Frame = -1 Query: 159 KSVS*DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 K + D PTA D LG+DFY+++LQEEPFK TTVKS++KSYRWAPFLPV DSS Sbjct: 173 KGLGKDAPTAADNLGQDFYQVILQEEPFKSTTVKSILKSYRWAPFLPVATDSS 225 >gb|EPS57875.1| hypothetical protein M569_16941, partial [Genlisea aurea] Length = 383 Score = 81.3 bits (199), Expect = 1e-15 Identities = 36/53 (67%), Positives = 44/53 (83%) Frame = -1 Query: 159 KSVS*DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 K + + PTA D LGEDFYK++L+EEPFK TT KS++KSYRWAPF+PV PDSS Sbjct: 117 KGIGRNAPTAADNLGEDFYKVILREEPFKSTTAKSILKSYRWAPFIPVGPDSS 169 >gb|KZV38822.1| hypothetical protein F511_21824 [Dorcoceras hygrometricum] Length = 444 Score = 81.3 bits (199), Expect = 1e-15 Identities = 37/53 (69%), Positives = 43/53 (81%) Frame = -1 Query: 159 KSVS*DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 K + D PTA D LGEDFYK+LL EEPFK TTV+S++KSYRWAPF+PV DSS Sbjct: 173 KGMGKDAPTAADKLGEDFYKVLLNEEPFKSTTVRSILKSYRWAPFVPVATDSS 225 >ref|XP_021299605.1| SNF1-related protein kinase regulatory subunit gamma-1-like [Herrania umbratica] Length = 468 Score = 81.3 bits (199), Expect = 1e-15 Identities = 37/53 (69%), Positives = 44/53 (83%) Frame = -1 Query: 159 KSVS*DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 + V D P+A D LGEDFYK++LQEEPFK TTV+S+VKSYRWAPF+PV DSS Sbjct: 197 QGVGKDAPSAADNLGEDFYKVILQEEPFKSTTVRSIVKSYRWAPFVPVATDSS 249 >gb|EOY02036.1| Cystathionine beta-synthase protein isoform 1 [Theobroma cacao] Length = 474 Score = 81.3 bits (199), Expect = 1e-15 Identities = 37/53 (69%), Positives = 44/53 (83%) Frame = -1 Query: 159 KSVS*DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 + V D P+A D LGEDFYK++LQEEPFK TTV+S+VKSYRWAPF+PV DSS Sbjct: 203 QGVGKDAPSAADNLGEDFYKVILQEEPFKSTTVRSIVKSYRWAPFVPVATDSS 255 >ref|XP_022850630.1| SNF1-related protein kinase regulatory subunit gamma-1-like [Olea europaea var. sylvestris] ref|XP_022850631.1| SNF1-related protein kinase regulatory subunit gamma-1-like [Olea europaea var. sylvestris] Length = 448 Score = 80.9 bits (198), Expect = 2e-15 Identities = 36/53 (67%), Positives = 44/53 (83%) Frame = -1 Query: 159 KSVS*DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 K + D PTA + LGEDFYK++LQEEPFK TTV+S++KSYRWAPF+PV DSS Sbjct: 173 KGIGKDAPTAANKLGEDFYKIILQEEPFKSTTVRSILKSYRWAPFIPVGKDSS 225 >ref|XP_009410765.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like isoform X3 [Musa acuminata subsp. malaccensis] Length = 382 Score = 80.5 bits (197), Expect = 2e-15 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = -1 Query: 162 KKSVS*DLPTAVDPLGEDFYKLLLQEEPFKLTTVKSVVKSYRWAPFLPVLPDSS 1 +K + D P+AVD LGEDFYK LL+EEPFK TTVKS+++SYRWAPFLPV DSS Sbjct: 169 EKGMGKDAPSAVDDLGEDFYKTLLEEEPFKSTTVKSIMESYRWAPFLPVGLDSS 222