BLASTX nr result
ID: Ophiopogon24_contig00028614
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00028614 (550 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015086945.1| PREDICTED: shaggy-related protein kinase eta... 60 6e-08 ref|XP_015057681.1| PREDICTED: shaggy-related protein kinase eta... 60 9e-08 gb|OIV93497.1| hypothetical protein TanjilG_11079 [Lupinus angus... 59 2e-07 gb|KZN09379.1| hypothetical protein DCAR_002035 [Daucus carota s... 60 2e-07 ref|XP_017257889.1| PREDICTED: shaggy-related protein kinase eta... 60 3e-07 ref|XP_017257881.1| PREDICTED: shaggy-related protein kinase eta... 60 3e-07 emb|CDY10766.1| BnaA05g11700D [Brassica napus] 59 3e-07 gb|EEF35731.1| Glycogen synthase kinase-3 beta, putative [Ricinu... 59 4e-07 ref|XP_007148029.1| hypothetical protein PHAVU_006G1745001g, par... 57 4e-07 emb|CAA72330.1| shaggy-like kinase, partial [Ricinus communis] 59 5e-07 ref|XP_024004106.1| shaggy-related protein kinase zeta-like [Eut... 59 5e-07 gb|PNT12181.1| hypothetical protein POPTR_011G068600v3 [Populus ... 59 5e-07 gb|KDO77892.1| hypothetical protein CISIN_1g016950mg [Citrus sin... 59 5e-07 ref|XP_016448649.1| PREDICTED: shaggy-related protein kinase eta... 59 5e-07 ref|XP_013637472.1| PREDICTED: shaggy-related protein kinase zet... 59 5e-07 gb|KDO77888.1| hypothetical protein CISIN_1g016950mg [Citrus sin... 59 5e-07 gb|PNT12182.1| hypothetical protein POPTR_011G068600v3 [Populus ... 59 6e-07 ref|XP_017180614.1| PREDICTED: shaggy-related protein kinase eta... 59 6e-07 gb|PHU19041.1| Shaggy-related protein kinase iota [Capsicum chin... 59 6e-07 gb|PHT76746.1| Shaggy-related protein kinase zeta [Capsicum annuum] 59 6e-07 >ref|XP_015086945.1| PREDICTED: shaggy-related protein kinase eta-like [Solanum pennellii] Length = 200 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/38 (71%), Positives = 28/38 (73%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKVGN*YIFVIFSG*IIC 116 RCMNPNYTDFRFPQIKAHPWHKV V+ G IC Sbjct: 152 RCMNPNYTDFRFPQIKAHPWHKVCFHLTLVVPRGTTIC 189 >ref|XP_015057681.1| PREDICTED: shaggy-related protein kinase eta-like [Solanum pennellii] Length = 227 Score = 60.5 bits (145), Expect = 9e-08 Identities = 27/38 (71%), Positives = 28/38 (73%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKVGN*YIFVIFSG*IIC 116 RCMNPNYTDFRFPQIKAHPWHKV V+ G IC Sbjct: 179 RCMNPNYTDFRFPQIKAHPWHKVCFHLTLVVPRGTTIC 216 >gb|OIV93497.1| hypothetical protein TanjilG_11079 [Lupinus angustifolius] Length = 180 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKV 71 RCMNPNYTDFRFPQIKAHPWHK+ Sbjct: 100 RCMNPNYTDFRFPQIKAHPWHKI 122 >gb|KZN09379.1| hypothetical protein DCAR_002035 [Daucus carota subsp. sativus] Length = 368 Score = 60.1 bits (144), Expect = 2e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKVGN 77 RCMNPNYTDFRFPQIKAHPWHKV N Sbjct: 260 RCMNPNYTDFRFPQIKAHPWHKVFN 284 >ref|XP_017257889.1| PREDICTED: shaggy-related protein kinase eta-like isoform X2 [Daucus carota subsp. sativus] Length = 396 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKVGN 77 RCMNPNYTDFRFPQIKAHPWHKV N Sbjct: 288 RCMNPNYTDFRFPQIKAHPWHKVFN 312 >ref|XP_017257881.1| PREDICTED: shaggy-related protein kinase eta-like isoform X1 [Daucus carota subsp. sativus] Length = 401 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKVGN 77 RCMNPNYTDFRFPQIKAHPWHKV N Sbjct: 293 RCMNPNYTDFRFPQIKAHPWHKVFN 317 >emb|CDY10766.1| BnaA05g11700D [Brassica napus] Length = 224 Score = 58.9 bits (141), Expect = 3e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKV 71 RCMNPNYTDFRFPQIKAHPWHKV Sbjct: 142 RCMNPNYTDFRFPQIKAHPWHKV 164 >gb|EEF35731.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis] Length = 266 Score = 58.9 bits (141), Expect = 4e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKV 71 RCMNPNYTDFRFPQIKAHPWHKV Sbjct: 152 RCMNPNYTDFRFPQIKAHPWHKV 174 >ref|XP_007148029.1| hypothetical protein PHAVU_006G1745001g, partial [Phaseolus vulgaris] gb|ESW20023.1| hypothetical protein PHAVU_006G1745001g, partial [Phaseolus vulgaris] Length = 123 Score = 56.6 bits (135), Expect = 4e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKV 71 RCMNPNY DFRFPQIKAHPWHK+ Sbjct: 9 RCMNPNYNDFRFPQIKAHPWHKI 31 >emb|CAA72330.1| shaggy-like kinase, partial [Ricinus communis] Length = 277 Score = 58.9 bits (141), Expect = 5e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKV 71 RCMNPNYTDFRFPQIKAHPWHKV Sbjct: 163 RCMNPNYTDFRFPQIKAHPWHKV 185 >ref|XP_024004106.1| shaggy-related protein kinase zeta-like [Eutrema salsugineum] Length = 290 Score = 58.9 bits (141), Expect = 5e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKVGN*YIFVIFS 101 RCMNPN+TDFRFPQIKAHPWHKV Y+ V FS Sbjct: 182 RCMNPNFTDFRFPQIKAHPWHKVF--YMHVTFS 212 >gb|PNT12181.1| hypothetical protein POPTR_011G068600v3 [Populus trichocarpa] Length = 296 Score = 58.9 bits (141), Expect = 5e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKV 71 RCMNPNYTDFRFPQIKAHPWHKV Sbjct: 182 RCMNPNYTDFRFPQIKAHPWHKV 204 >gb|KDO77892.1| hypothetical protein CISIN_1g016950mg [Citrus sinensis] Length = 296 Score = 58.9 bits (141), Expect = 5e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKV 71 RCMNPNYTDFRFPQIKAHPWHKV Sbjct: 182 RCMNPNYTDFRFPQIKAHPWHKV 204 >ref|XP_016448649.1| PREDICTED: shaggy-related protein kinase eta-like [Nicotiana tabacum] Length = 301 Score = 58.9 bits (141), Expect = 5e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKV 71 RCMNPNYTDFRFPQIKAHPWHKV Sbjct: 266 RCMNPNYTDFRFPQIKAHPWHKV 288 >ref|XP_013637472.1| PREDICTED: shaggy-related protein kinase zeta-like [Brassica oleracea var. oleracea] Length = 303 Score = 58.9 bits (141), Expect = 5e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKV 71 RCMNPNYTDFRFPQIKAHPWHKV Sbjct: 189 RCMNPNYTDFRFPQIKAHPWHKV 211 >gb|KDO77888.1| hypothetical protein CISIN_1g016950mg [Citrus sinensis] Length = 314 Score = 58.9 bits (141), Expect = 5e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKV 71 RCMNPNYTDFRFPQIKAHPWHKV Sbjct: 266 RCMNPNYTDFRFPQIKAHPWHKV 288 >gb|PNT12182.1| hypothetical protein POPTR_011G068600v3 [Populus trichocarpa] Length = 325 Score = 58.9 bits (141), Expect = 6e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKV 71 RCMNPNYTDFRFPQIKAHPWHKV Sbjct: 266 RCMNPNYTDFRFPQIKAHPWHKV 288 >ref|XP_017180614.1| PREDICTED: shaggy-related protein kinase eta [Malus domestica] Length = 339 Score = 58.9 bits (141), Expect = 6e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKV 71 RCMNPNYTDFRFPQIKAHPWHKV Sbjct: 226 RCMNPNYTDFRFPQIKAHPWHKV 248 >gb|PHU19041.1| Shaggy-related protein kinase iota [Capsicum chinense] Length = 346 Score = 58.9 bits (141), Expect = 6e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKV 71 RCMNPNYTDFRFPQIKAHPWHKV Sbjct: 230 RCMNPNYTDFRFPQIKAHPWHKV 252 >gb|PHT76746.1| Shaggy-related protein kinase zeta [Capsicum annuum] Length = 346 Score = 58.9 bits (141), Expect = 6e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 RCMNPNYTDFRFPQIKAHPWHKV 71 RCMNPNYTDFRFPQIKAHPWHKV Sbjct: 230 RCMNPNYTDFRFPQIKAHPWHKV 252