BLASTX nr result
ID: Ophiopogon24_contig00028583
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00028583 (370 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020276793.1| uncharacterized protein LOC109851100 [Aspara... 57 5e-07 >ref|XP_020276793.1| uncharacterized protein LOC109851100 [Asparagus officinalis] gb|ONK65305.1| uncharacterized protein A4U43_C07F35760 [Asparagus officinalis] Length = 240 Score = 56.6 bits (135), Expect = 5e-07 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -3 Query: 368 RSNFVSSVYPVTSWSLTPSRKRTANTYGFVSSKFRKFCSE 249 R+NFVSSV P +S + P+RKRT NTYGF+SSKFR+F +E Sbjct: 199 RANFVSSVRPSSSLIMPPTRKRTTNTYGFISSKFRRFHNE 238