BLASTX nr result
ID: Ophiopogon24_contig00028397
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00028397 (473 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU48480.1| hypothetical protein TSUD_291650 [Trifolium subt... 95 1e-20 gb|PNX92527.1| hypothetical protein L195_g015665 [Trifolium prat... 64 3e-09 dbj|GAU32066.1| hypothetical protein TSUD_53340 [Trifolium subte... 54 2e-06 >dbj|GAU48480.1| hypothetical protein TSUD_291650 [Trifolium subterraneum] Length = 282 Score = 95.1 bits (235), Expect = 1e-20 Identities = 46/56 (82%), Positives = 48/56 (85%) Frame = +2 Query: 179 LHSTLSF*ASVLGPGIRKDGKETTTPDRCPRSGLGSG*HPSLYRSFPRHTINRHNE 346 LHSTLSF +SVLGPGIRKDGKETTTPDRCPRSG HPSLYRS PRHTIN HN+ Sbjct: 209 LHSTLSFRSSVLGPGIRKDGKETTTPDRCPRSGY----HPSLYRSLPRHTINGHNQ 260 >gb|PNX92527.1| hypothetical protein L195_g015665 [Trifolium pratense] Length = 287 Score = 64.3 bits (155), Expect = 3e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 179 LHSTLSF*ASVLGPGIRKDGKETTTPDRCPRSGL 280 LHSTLSF +SVLGPGIRKDGKETTTPDRCPR + Sbjct: 50 LHSTLSFRSSVLGPGIRKDGKETTTPDRCPRDAI 83 >dbj|GAU32066.1| hypothetical protein TSUD_53340 [Trifolium subterraneum] Length = 102 Score = 53.9 bits (128), Expect = 2e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -1 Query: 305 RERGVNLNQDLTWDIDLELWSPYHPFVCLDLERRL 201 RERG N+ TWD DLELWSP HP VCLDLERR+ Sbjct: 72 RERGGNM----TWDTDLELWSPSHPCVCLDLERRI 102