BLASTX nr result
ID: Ophiopogon24_contig00028211
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00028211 (388 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008784837.1| PREDICTED: solanesyl-diphosphate synthase 1,... 65 7e-10 ref|XP_017697433.1| PREDICTED: solanesyl-diphosphate synthase 1,... 65 9e-10 ref|XP_020277283.1| solanesyl-diphosphate synthase 1, mitochondr... 65 1e-09 ref|XP_020277275.1| solanesyl-diphosphate synthase 1, mitochondr... 65 2e-09 ref|XP_020277177.1| solanesyl-diphosphate synthase 1, mitochondr... 65 2e-09 ref|XP_010940826.1| PREDICTED: solanesyl-diphosphate synthase 1,... 64 2e-09 ref|XP_010940821.1| PREDICTED: solanesyl-diphosphate synthase 1,... 64 2e-09 ref|XP_020257852.1| solanesyl-diphosphate synthase 1, mitochondr... 63 6e-09 ref|XP_020257851.1| solanesyl-diphosphate synthase 1, mitochondr... 63 7e-09 ref|XP_020257850.1| solanesyl-diphosphate synthase 1, mitochondr... 63 7e-09 gb|OEL17951.1| Solanesyl-diphosphate synthase 1, mitochondrial [... 63 7e-09 ref|XP_010240683.1| PREDICTED: solanesyl-diphosphate synthase 1,... 62 8e-09 ref|XP_008787644.1| PREDICTED: solanesyl-diphosphate synthase 1,... 62 8e-09 ref|XP_008787643.1| PREDICTED: solanesyl-diphosphate synthase 1,... 62 1e-08 ref|XP_003563402.1| PREDICTED: solanesyl-diphosphate synthase 1,... 62 1e-08 ref|XP_020109505.1| solanesyl-diphosphate synthase 1, mitochondr... 62 2e-08 ref|XP_020109504.1| solanesyl-diphosphate synthase 1, mitochondr... 62 2e-08 gb|OAY63552.1| Solanesyl-diphosphate synthase 1, mitochondrial [... 62 2e-08 ref|XP_020157104.1| solanesyl-diphosphate synthase 1, mitochondr... 61 2e-08 ref|XP_015644452.1| PREDICTED: solanesyl-diphosphate synthase 1,... 61 2e-08 >ref|XP_008784837.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform X1 [Phoenix dactylifera] Length = 288 Score = 65.1 bits (157), Expect = 7e-10 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 A+EHA+RAV+AIEALP ++ ED ++SRRALVDLTRRVITRTK Sbjct: 247 AEEHASRAVEAIEALPCSDDEDVQVSRRALVDLTRRVITRTK 288 >ref|XP_017697433.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform X2 [Phoenix dactylifera] Length = 321 Score = 65.1 bits (157), Expect = 9e-10 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 A+EHA+RAV+AIEALP ++ ED ++SRRALVDLTRRVITRTK Sbjct: 280 AEEHASRAVEAIEALPCSDDEDVQVSRRALVDLTRRVITRTK 321 >ref|XP_020277283.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X4 [Asparagus officinalis] Length = 321 Score = 64.7 bits (156), Expect = 1e-09 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 AQEH AV AIEALPET E+ARISRRALVDLT+RVITRTK Sbjct: 280 AQEHVNLAVNAIEALPETISENARISRRALVDLTKRVITRTK 321 >ref|XP_020277275.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X3 [Asparagus officinalis] gb|ONK79614.1| uncharacterized protein A4U43_C01F8160 [Asparagus officinalis] Length = 419 Score = 64.7 bits (156), Expect = 2e-09 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 AQEH AV AIEALPET E+ARISRRALVDLT+RVITRTK Sbjct: 378 AQEHVNLAVNAIEALPETISENARISRRALVDLTKRVITRTK 419 >ref|XP_020277177.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X1 [Asparagus officinalis] ref|XP_020277184.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X1 [Asparagus officinalis] ref|XP_020277191.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X1 [Asparagus officinalis] ref|XP_020277200.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X1 [Asparagus officinalis] ref|XP_020277208.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X1 [Asparagus officinalis] ref|XP_020277217.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X1 [Asparagus officinalis] ref|XP_020277227.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X1 [Asparagus officinalis] ref|XP_020277236.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X1 [Asparagus officinalis] ref|XP_020277244.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X1 [Asparagus officinalis] ref|XP_020277252.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X1 [Asparagus officinalis] ref|XP_020277257.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X1 [Asparagus officinalis] ref|XP_020277261.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X1 [Asparagus officinalis] ref|XP_020277268.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X2 [Asparagus officinalis] Length = 420 Score = 64.7 bits (156), Expect = 2e-09 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 AQEH AV AIEALPET E+ARISRRALVDLT+RVITRTK Sbjct: 379 AQEHVNLAVNAIEALPETISENARISRRALVDLTKRVITRTK 420 >ref|XP_010940826.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform X2 [Elaeis guineensis] Length = 321 Score = 64.3 bits (155), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 AQEHA RAVKAIEALP ++ ED ++SRRALVDLT RVITRTK Sbjct: 280 AQEHANRAVKAIEALPYSDDEDIQMSRRALVDLTHRVITRTK 321 >ref|XP_010940821.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform X1 [Elaeis guineensis] Length = 418 Score = 64.3 bits (155), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 AQEHA RAVKAIEALP ++ ED ++SRRALVDLT RVITRTK Sbjct: 377 AQEHANRAVKAIEALPYSDDEDIQMSRRALVDLTHRVITRTK 418 >ref|XP_020257852.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X3 [Asparagus officinalis] ref|XP_020257853.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X3 [Asparagus officinalis] ref|XP_020257854.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X3 [Asparagus officinalis] ref|XP_020257855.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X3 [Asparagus officinalis] ref|XP_020257856.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X3 [Asparagus officinalis] Length = 321 Score = 62.8 bits (151), Expect = 6e-09 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 AQEH AV AIEALPET E+A ISRRALVDLT+RVITRTK Sbjct: 280 AQEHVNLAVNAIEALPETISENAHISRRALVDLTKRVITRTK 321 >ref|XP_020257851.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X2 [Asparagus officinalis] gb|ONK76057.1| uncharacterized protein A4U43_C03F23420 [Asparagus officinalis] Length = 419 Score = 62.8 bits (151), Expect = 7e-09 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 AQEH AV AIEALPET E+A ISRRALVDLT+RVITRTK Sbjct: 378 AQEHVNLAVNAIEALPETISENAHISRRALVDLTKRVITRTK 419 >ref|XP_020257850.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X1 [Asparagus officinalis] Length = 420 Score = 62.8 bits (151), Expect = 7e-09 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 AQEH AV AIEALPET E+A ISRRALVDLT+RVITRTK Sbjct: 379 AQEHVNLAVNAIEALPETISENAHISRRALVDLTKRVITRTK 420 >gb|OEL17951.1| Solanesyl-diphosphate synthase 1, mitochondrial [Dichanthelium oligosanthes] Length = 456 Score = 62.8 bits (151), Expect = 7e-09 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 AQEHA RA+KAIEALP+++ ED SRRAL+D+T RVITRTK Sbjct: 415 AQEHANRAIKAIEALPDSDDEDVLTSRRALIDITERVITRTK 456 >ref|XP_010240683.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform X2 [Brachypodium distachyon] ref|XP_010240685.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform X2 [Brachypodium distachyon] gb|KQK17110.1| hypothetical protein BRADI_1g32530v3 [Brachypodium distachyon] Length = 321 Score = 62.4 bits (150), Expect = 8e-09 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 AQEHA A+KAIEALP+++ ED ISRRAL+D+T+RVITRTK Sbjct: 280 AQEHANLAIKAIEALPDSDDEDVLISRRALIDITQRVITRTK 321 >ref|XP_008787644.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like isoform X2 [Phoenix dactylifera] Length = 321 Score = 62.4 bits (150), Expect = 8e-09 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 A EHA RAV+AI+ALPE++ ED ISRRALVDLT RVITRTK Sbjct: 280 AAEHANRAVEAIDALPESDDEDVLISRRALVDLTHRVITRTK 321 >ref|XP_008787643.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like isoform X1 [Phoenix dactylifera] Length = 419 Score = 62.4 bits (150), Expect = 1e-08 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 A EHA RAV+AI+ALPE++ ED ISRRALVDLT RVITRTK Sbjct: 378 AAEHANRAVEAIDALPESDDEDVLISRRALVDLTHRVITRTK 419 >ref|XP_003563402.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform X1 [Brachypodium distachyon] gb|KQK17109.1| hypothetical protein BRADI_1g32530v3 [Brachypodium distachyon] Length = 426 Score = 62.4 bits (150), Expect = 1e-08 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 AQEHA A+KAIEALP+++ ED ISRRAL+D+T+RVITRTK Sbjct: 385 AQEHANLAIKAIEALPDSDDEDVLISRRALIDITQRVITRTK 426 >ref|XP_020109505.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X2 [Ananas comosus] Length = 321 Score = 61.6 bits (148), Expect = 2e-08 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 A EHA RAV+AIEA PE++ ED ISRRALVDLT RVITRTK Sbjct: 280 AAEHANRAVEAIEAFPESDDEDVIISRRALVDLTNRVITRTK 321 >ref|XP_020109504.1| solanesyl-diphosphate synthase 1, mitochondrial-like isoform X1 [Ananas comosus] Length = 422 Score = 61.6 bits (148), Expect = 2e-08 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 A EHA RAV+AIEA PE++ ED ISRRALVDLT RVITRTK Sbjct: 381 AAEHANRAVEAIEAFPESDDEDVIISRRALVDLTNRVITRTK 422 >gb|OAY63552.1| Solanesyl-diphosphate synthase 1, mitochondrial [Ananas comosus] Length = 422 Score = 61.6 bits (148), Expect = 2e-08 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 A EHA RAV+AIEA PE++ ED ISRRALVDLT RVITRTK Sbjct: 381 AAEHANRAVEAIEAFPESDDEDVIISRRALVDLTNRVITRTK 422 >ref|XP_020157104.1| solanesyl-diphosphate synthase 1, mitochondrial isoform X2 [Aegilops tauschii subsp. tauschii] Length = 321 Score = 61.2 bits (147), Expect = 2e-08 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 AQEH AVKAIEALP+++ ED ISRRAL+D+T+RVITRTK Sbjct: 280 AQEHVNLAVKAIEALPDSDDEDVLISRRALIDITQRVITRTK 321 >ref|XP_015644452.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform X2 [Oryza sativa Japonica Group] Length = 321 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = +3 Query: 3 AQEHAARAVKAIEALPETNGEDARISRRALVDLTRRVITRTK 128 A+EHA RA+KAIEALP+++ ED SRRAL+D+T RVITRTK Sbjct: 280 AREHANRAIKAIEALPDSDDEDVLTSRRALIDITERVITRTK 321