BLASTX nr result
ID: Ophiopogon24_contig00028072
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00028072 (489 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020266756.1| pentatricopeptide repeat-containing protein ... 44 2e-07 gb|ONK69577.1| uncharacterized protein A4U43_C05F24430 [Asparagu... 44 2e-07 >ref|XP_020266756.1| pentatricopeptide repeat-containing protein At3g61360 [Asparagus officinalis] Length = 298 Score = 43.5 bits (101), Expect(2) = 2e-07 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = +3 Query: 90 FRGVCRF*WRMAERRYVPRVRTAMLPTKYFSESSRS 197 F GVC +M ER YVPRVRT ML KYF E RS Sbjct: 158 FDGVCEVYRKMKERDYVPRVRTVMLLMKYFCEKRRS 193 Score = 39.3 bits (90), Expect(2) = 2e-07 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +2 Query: 2 DEMEGKVLGVDDVRYCALFCGLRRVGPLE 88 DEME K +GVDDV Y LFCG+++ G + Sbjct: 131 DEMERKDVGVDDVSYYTLFCGMKKAGDFD 159 >gb|ONK69577.1| uncharacterized protein A4U43_C05F24430 [Asparagus officinalis] Length = 169 Score = 43.5 bits (101), Expect(2) = 2e-07 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = +3 Query: 90 FRGVCRF*WRMAERRYVPRVRTAMLPTKYFSESSRS 197 F GVC +M ER YVPRVRT ML KYF E RS Sbjct: 29 FDGVCEVYRKMKERDYVPRVRTVMLLMKYFCEKRRS 64 Score = 39.3 bits (90), Expect(2) = 2e-07 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +2 Query: 2 DEMEGKVLGVDDVRYCALFCGLRRVGPLE 88 DEME K +GVDDV Y LFCG+++ G + Sbjct: 2 DEMERKDVGVDDVSYYTLFCGMKKAGDFD 30