BLASTX nr result
ID: Ophiopogon24_contig00027937
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00027937 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241326.1| K(+) efflux antiporter 2, chloroplastic-like... 91 2e-18 >ref|XP_020241326.1| K(+) efflux antiporter 2, chloroplastic-like [Asparagus officinalis] ref|XP_020241335.1| K(+) efflux antiporter 2, chloroplastic-like [Asparagus officinalis] gb|ONK79684.1| uncharacterized protein A4U43_C01F8990 [Asparagus officinalis] Length = 1152 Score = 90.9 bits (224), Expect = 2e-18 Identities = 52/88 (59%), Positives = 59/88 (67%), Gaps = 3/88 (3%) Frame = -1 Query: 257 MDLACGLHQCCVSSHRIGPSSRVLNFRIRFRAQNLNFGGDSRVFYRSGCLKRR---GDGK 87 MDLA GLHQ VSS+ SSRV N RIRFRAQ+LNF G SR F +S LKRR G+GK Sbjct: 1 MDLASGLHQSRVSSYGTFSSSRVSNSRIRFRAQSLNFAGASRAFSKSCALKRRNWNGNGK 60 Query: 86 ICSLFDLNGTSSTFLLRCQPNDSLAIVD 3 + SLF L+ F RCQ NDSLA +D Sbjct: 61 VSSLFPLSRNLCKFKRRCQSNDSLAFID 88