BLASTX nr result
ID: Ophiopogon24_contig00027855
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00027855 (428 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006482131.1| PREDICTED: glutathione S-transferase DHAR3, ... 55 5e-06 gb|KDO36316.1| hypothetical protein CISIN_1g040329mg, partial [C... 54 5e-06 gb|AQK83387.1| Glutathione S-transferase DHAR3 chloroplastic [Ze... 53 9e-06 >ref|XP_006482131.1| PREDICTED: glutathione S-transferase DHAR3, chloroplastic [Citrus sinensis] Length = 262 Score = 54.7 bits (130), Expect = 5e-06 Identities = 29/56 (51%), Positives = 36/56 (64%), Gaps = 3/56 (5%) Frame = +2 Query: 50 IGGLLSMGT*ALP---HENEITLGHYKNWSVPESLPHVKSYMKVLLE*CTHIHPKA 208 IGG +S +L + EI LGHYKNWSVP+SLPHVKSYMK + + I +A Sbjct: 192 IGGKVSAADLSLGPKFYHLEIALGHYKNWSVPDSLPHVKSYMKTIFSMDSFIKTRA 247 >gb|KDO36316.1| hypothetical protein CISIN_1g040329mg, partial [Citrus sinensis] Length = 164 Score = 53.5 bits (127), Expect = 5e-06 Identities = 27/43 (62%), Positives = 31/43 (72%), Gaps = 3/43 (6%) Frame = +2 Query: 50 IGGLLSMGT*ALP---HENEITLGHYKNWSVPESLPHVKSYMK 169 IGG +S +L + EI LGHYKNWSVP+SLPHVKSYMK Sbjct: 122 IGGKVSAADLSLGPKFYHLEIALGHYKNWSVPDSLPHVKSYMK 164 >gb|AQK83387.1| Glutathione S-transferase DHAR3 chloroplastic [Zea mays] Length = 152 Score = 52.8 bits (125), Expect = 9e-06 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 3/51 (5%) Frame = +2 Query: 53 GGLLSMGT*ALP---HENEITLGHYKNWSVPESLPHVKSYMKVLLE*CTHI 196 GG++S +L + EITLGHYKNWSVP+SL +VK+YMKV C H+ Sbjct: 101 GGIISAADLSLGPKLYHMEITLGHYKNWSVPDSLSYVKTYMKV----CIHV 147