BLASTX nr result
ID: Ophiopogon24_contig00027778
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00027778 (393 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261820.1| phosphoinositide phosphatase SAC1 [Asparagus... 54 8e-06 >ref|XP_020261820.1| phosphoinositide phosphatase SAC1 [Asparagus officinalis] gb|ONK72924.1| uncharacterized protein A4U43_C04F24970 [Asparagus officinalis] Length = 894 Score = 54.3 bits (129), Expect = 8e-06 Identities = 25/40 (62%), Positives = 28/40 (70%) Frame = -3 Query: 130 RDASHGEFRVSSGDLVRLGSGDTSNPMANQGGGNSTRQQC 11 RD S GEFR +S DL R S +TSNP+ANQ GG RQQC Sbjct: 437 RDTSLGEFRTNSADLARSVSSETSNPVANQNGGQDARQQC 476