BLASTX nr result
ID: Ophiopogon24_contig00027753
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00027753 (431 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KQL12631.1| hypothetical protein SETIT_021165mg [Setaria ital... 65 3e-09 ref|XP_019702929.1| PREDICTED: transportin-1-like isoform X3 [El... 65 3e-09 gb|OEL22827.1| Transportin-1 [Dichanthelium oligosanthes] 65 3e-09 gb|PAN40915.1| hypothetical protein PAHAL_C03764 [Panicum hallii] 65 3e-09 ref|XP_004959945.1| transportin-1 [Setaria italica] >gi|94424836... 65 3e-09 ref|XP_010909469.1| PREDICTED: transportin-1-like isoform X2 [El... 65 3e-09 ref|XP_010909468.1| PREDICTED: transportin-1-like isoform X1 [El... 65 3e-09 gb|ONM15685.1| Transportin-1 [Zea mays] >gi|1142656368|gb|ONM156... 64 5e-09 gb|ONM15694.1| Transportin-1 [Zea mays] 64 5e-09 gb|ONM15688.1| Transportin-1 [Zea mays] 64 5e-09 gb|ONM15689.1| Transportin-1 [Zea mays] 64 5e-09 gb|ONM15683.1| Transportin-1 [Zea mays] >gi|1142656370|gb|ONM156... 64 5e-09 gb|ONM15675.1| Transportin-1 [Zea mays] 64 5e-09 gb|ONM15676.1| Transportin-1 [Zea mays] >gi|1142656355|gb|ONM156... 64 5e-09 gb|ONM15681.1| Transportin-1 [Zea mays] 64 5e-09 gb|ONM15682.1| Transportin-1 [Zea mays] 64 5e-09 gb|ONM15684.1| Transportin-1 [Zea mays] 64 5e-09 gb|ONM15696.1| Transportin-1 [Zea mays] 64 5e-09 gb|ONM15691.1| Transportin-1 [Zea mays] 64 5e-09 gb|ONM15699.1| Transportin-1 [Zea mays] 64 5e-09 >gb|KQL12631.1| hypothetical protein SETIT_021165mg [Setaria italica] Length = 664 Score = 64.7 bits (156), Expect = 3e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 489 DTNKRVQEAACSAFATLEEEAAEELVPHLEVILQHLMCA 527 >ref|XP_019702929.1| PREDICTED: transportin-1-like isoform X3 [Elaeis guineensis] Length = 717 Score = 64.7 bits (156), Expect = 3e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 316 DTNKRVQEAACSAFATLEEEAAEELVPHLEVILQHLLCA 354 >gb|OEL22827.1| Transportin-1 [Dichanthelium oligosanthes] Length = 845 Score = 64.7 bits (156), Expect = 3e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 465 DTNKRVQEAACSAFATLEEEAAEELVPHLEVILQHLMCA 503 >gb|PAN40915.1| hypothetical protein PAHAL_C03764 [Panicum hallii] Length = 890 Score = 64.7 bits (156), Expect = 3e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 489 DTNKRVQEAACSAFATLEEEAAEELVPHLEVILQHLMCA 527 >ref|XP_004959945.1| transportin-1 [Setaria italica] gb|KQL12630.1| hypothetical protein SETIT_021165mg [Setaria italica] Length = 890 Score = 64.7 bits (156), Expect = 3e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 489 DTNKRVQEAACSAFATLEEEAAEELVPHLEVILQHLMCA 527 >ref|XP_010909469.1| PREDICTED: transportin-1-like isoform X2 [Elaeis guineensis] Length = 891 Score = 64.7 bits (156), Expect = 3e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 490 DTNKRVQEAACSAFATLEEEAAEELVPHLEVILQHLLCA 528 >ref|XP_010909468.1| PREDICTED: transportin-1-like isoform X1 [Elaeis guineensis] Length = 898 Score = 64.7 bits (156), Expect = 3e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 497 DTNKRVQEAACSAFATLEEEAAEELVPHLEVILQHLLCA 535 >gb|ONM15685.1| Transportin-1 [Zea mays] gb|ONM15690.1| Transportin-1 [Zea mays] Length = 502 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 100 DTNKRVQEAACSAFATLEEEASEELVPHLEVILQHLMCA 138 >gb|ONM15694.1| Transportin-1 [Zea mays] Length = 543 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 344 DTNKRVQEAACSAFATLEEEASEELVPHLEVILQHLMCA 382 >gb|ONM15688.1| Transportin-1 [Zea mays] Length = 600 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 198 DTNKRVQEAACSAFATLEEEASEELVPHLEVILQHLMCA 236 >gb|ONM15689.1| Transportin-1 [Zea mays] Length = 625 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 489 DTNKRVQEAACSAFATLEEEASEELVPHLEVILQHLMCA 527 >gb|ONM15683.1| Transportin-1 [Zea mays] gb|ONM15692.1| Transportin-1 [Zea mays] gb|ONM15697.1| Transportin-1 [Zea mays] Length = 634 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 489 DTNKRVQEAACSAFATLEEEASEELVPHLEVILQHLMCA 527 >gb|ONM15675.1| Transportin-1 [Zea mays] Length = 661 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 489 DTNKRVQEAACSAFATLEEEASEELVPHLEVILQHLMCA 527 >gb|ONM15676.1| Transportin-1 [Zea mays] gb|ONM15677.1| Transportin-1 [Zea mays] gb|ONM15686.1| Transportin-1 [Zea mays] Length = 688 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 489 DTNKRVQEAACSAFATLEEEASEELVPHLEVILQHLMCA 527 >gb|ONM15681.1| Transportin-1 [Zea mays] Length = 712 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 310 DTNKRVQEAACSAFATLEEEASEELVPHLEVILQHLMCA 348 >gb|ONM15682.1| Transportin-1 [Zea mays] Length = 765 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 489 DTNKRVQEAACSAFATLEEEASEELVPHLEVILQHLMCA 527 >gb|ONM15684.1| Transportin-1 [Zea mays] Length = 830 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 456 DTNKRVQEAACSAFATLEEEASEELVPHLEVILQHLMCA 494 >gb|ONM15696.1| Transportin-1 [Zea mays] Length = 839 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 437 DTNKRVQEAACSAFATLEEEASEELVPHLEVILQHLMCA 475 >gb|ONM15691.1| Transportin-1 [Zea mays] Length = 844 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 456 DTNKRVQEAACSAFATLEEEASEELVPHLEVILQHLMCA 494 >gb|ONM15699.1| Transportin-1 [Zea mays] Length = 858 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 211 DTNKLVQEATCSVFATLEEEAVEEFVPHFEIILQYLVCS 95 DTNK VQEA CS FATLEEEA EE VPH E+ILQ+L+C+ Sbjct: 456 DTNKRVQEAACSAFATLEEEASEELVPHLEVILQHLMCA 494