BLASTX nr result
ID: Ophiopogon24_contig00027578
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00027578 (551 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253671.1| cell division control protein 48 homolog D-l... 67 2e-11 gb|PPR87529.1| hypothetical protein GOBAR_AA33159 [Gossypium bar... 65 1e-10 gb|PNX60371.1| cell division cycle protein 48, partial [Trifoliu... 64 2e-10 gb|OVA18019.1| CDC48 [Macleaya cordata] 67 1e-09 gb|ONK79503.1| uncharacterized protein A4U43_C01F7020 [Asparagus... 67 1e-09 ref|XP_009408125.1| PREDICTED: cell division cycle protein 48 ho... 67 2e-09 ref|XP_020271764.1| cell division cycle protein 48 homolog [Aspa... 66 2e-09 ref|XP_010933081.1| PREDICTED: cell division cycle protein 48 ho... 66 2e-09 ref|XP_008784494.1| PREDICTED: cell division cycle protein 48 ho... 66 2e-09 ref|XP_008776881.1| PREDICTED: cell division cycle protein 48 ho... 65 5e-09 ref|XP_017639864.1| PREDICTED: cell division cycle protein 48 ho... 65 5e-09 gb|KYP49163.1| Cell division cycle protein 48 isogeny [Cajanus c... 65 5e-09 ref|XP_009773911.1| PREDICTED: cell division control protein 48 ... 61 5e-09 ref|XP_010241862.2| PREDICTED: cell division cycle protein 48 ho... 65 6e-09 gb|EXC16185.1| Cell division cycle protein 48-like protein [Moru... 65 6e-09 ref|XP_011018733.1| PREDICTED: cell division cycle protein 48 ho... 65 6e-09 ref|XP_024028710.1| cell division cycle protein 48 homolog [Moru... 65 6e-09 gb|KZV26055.1| Transitional endoplasmic reticulum ATPase [Dorcoc... 65 6e-09 gb|KVI09510.1| AAA+ ATPase domain-containing protein [Cynara car... 65 6e-09 ref|XP_017246991.1| PREDICTED: cell division control protein 48 ... 65 6e-09 >ref|XP_020253671.1| cell division control protein 48 homolog D-like [Asparagus officinalis] Length = 92 Score = 67.0 bits (162), Expect = 2e-11 Identities = 34/51 (66%), Positives = 38/51 (74%) Frame = +3 Query: 348 KGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSFNPETMEKL*LFRKDT 500 KG + ILERK+A NRLVVDE +NDDN V+S NPETMEKL LFR DT Sbjct: 15 KGAKRDFSTAILERKKAANRLVVDEAVNDDNSVVSLNPETMEKLQLFRGDT 65 >gb|PPR87529.1| hypothetical protein GOBAR_AA33159 [Gossypium barbadense] Length = 89 Score = 65.1 bits (157), Expect = 1e-10 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 2/70 (2%) Frame = +3 Query: 348 KGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSFNPETMEKL*LFRKDTRSSRCKL-- 521 KG + ILERK+A NRLVVDE +NDDN V+S +P+TMEKL LFR DT + KL Sbjct: 11 KGAKKDFSTAILERKKAANRLVVDEAINDDNSVVSLHPDTMEKLQLFRGDTILIKKKLPI 70 Query: 522 FGLLKECMKH 551 F +++ + H Sbjct: 71 FDEIRKVLHH 80 >gb|PNX60371.1| cell division cycle protein 48, partial [Trifolium pratense] Length = 65 Score = 63.9 bits (154), Expect = 2e-10 Identities = 32/51 (62%), Positives = 38/51 (74%) Frame = +3 Query: 348 KGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSFNPETMEKL*LFRKDT 500 KG + ILERK+A NRLVVDE +NDDN V++ +PETMEKL LFR DT Sbjct: 11 KGNKRDFSTAILERKKAPNRLVVDEAVNDDNSVVALHPETMEKLQLFRGDT 61 >gb|OVA18019.1| CDC48 [Macleaya cordata] Length = 808 Score = 67.0 bits (162), Expect = 1e-09 Identities = 34/51 (66%), Positives = 38/51 (74%) Frame = +3 Query: 348 KGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSFNPETMEKL*LFRKDT 500 KG + ILERK+A NRLVVDE +NDDN V+S NPETMEKL LFR DT Sbjct: 11 KGTKRDFSTAILERKKAANRLVVDEAINDDNSVVSMNPETMEKLQLFRGDT 61 >gb|ONK79503.1| uncharacterized protein A4U43_C01F7020 [Asparagus officinalis] Length = 810 Score = 67.0 bits (162), Expect = 1e-09 Identities = 34/51 (66%), Positives = 38/51 (74%) Frame = +3 Query: 348 KGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSFNPETMEKL*LFRKDT 500 KG + ILERK+A NRLVVDE +NDDN V+S NPETMEKL LFR DT Sbjct: 15 KGAKRDFSTAILERKKAANRLVVDEAVNDDNSVVSLNPETMEKLQLFRGDT 65 >ref|XP_009408125.1| PREDICTED: cell division cycle protein 48 homolog [Musa acuminata subsp. malaccensis] Length = 812 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = +3 Query: 348 KGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSFNPETMEKL*LFRKDT 500 KG + ILERK+A NRL+VDE +NDDN V+S NPETMEKL LFR DT Sbjct: 14 KGAKKDFSTAILERKKAANRLIVDEAINDDNSVVSLNPETMEKLQLFRGDT 64 >ref|XP_020271764.1| cell division cycle protein 48 homolog [Asparagus officinalis] gb|ONK63745.1| uncharacterized protein A4U43_C07F18470 [Asparagus officinalis] Length = 811 Score = 66.2 bits (160), Expect = 2e-09 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = +3 Query: 348 KGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSFNPETMEKL*LFRKDT 500 KG + ILERK+A NRLVVDE +NDDN V+S NPETMEKL +FR DT Sbjct: 15 KGTKRDFSTAILERKKAANRLVVDEAVNDDNSVVSLNPETMEKLQIFRGDT 65 >ref|XP_010933081.1| PREDICTED: cell division cycle protein 48 homolog [Elaeis guineensis] Length = 811 Score = 66.2 bits (160), Expect = 2e-09 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = +3 Query: 348 KGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSFNPETMEKL*LFRKDT 500 KG + ILERK+A NRL+VDE +NDDN V+S NPETMEKL LFR DT Sbjct: 14 KGAKKDFSTAILERKKAPNRLIVDEAINDDNSVVSMNPETMEKLQLFRGDT 64 >ref|XP_008784494.1| PREDICTED: cell division cycle protein 48 homolog [Phoenix dactylifera] Length = 811 Score = 66.2 bits (160), Expect = 2e-09 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = +3 Query: 348 KGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSFNPETMEKL*LFRKDT 500 KG + ILERK+A NRL+VDE +NDDN V+S NPETMEKL LFR DT Sbjct: 14 KGAKKDFSTAILERKKAPNRLIVDEAINDDNSVVSMNPETMEKLQLFRGDT 64 >ref|XP_008776881.1| PREDICTED: cell division cycle protein 48 homolog [Phoenix dactylifera] Length = 811 Score = 65.5 bits (158), Expect = 5e-09 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = +3 Query: 348 KGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSFNPETMEKL*LFRKDT 500 KG + IL+RK+A NRLVVDE +NDDN V+S NPETMEKL LFR DT Sbjct: 14 KGAKKDFSTAILDRKKAPNRLVVDEAINDDNSVVSMNPETMEKLQLFRGDT 64 >ref|XP_017639864.1| PREDICTED: cell division cycle protein 48 homolog, partial [Gossypium arboreum] Length = 812 Score = 65.5 bits (158), Expect = 5e-09 Identities = 33/60 (55%), Positives = 43/60 (71%) Frame = +3 Query: 321 WILVGLAFRKGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSFNPETMEKL*LFRKDT 500 ++++ FRKG + ILERK+A NRLVVDE +NDDN V+S + +TMEKL LFR DT Sbjct: 9 YLILIFRFRKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVSLHSDTMEKLQLFRGDT 68 >gb|KYP49163.1| Cell division cycle protein 48 isogeny [Cajanus cajan] Length = 831 Score = 65.5 bits (158), Expect = 5e-09 Identities = 37/77 (48%), Positives = 46/77 (59%) Frame = +3 Query: 270 ILFFFTSIIRFKFCLR*WILVGLAFRKGQRGILKHVILERKRATNRLVVDEVMNDDNFVM 449 I FFF+ F +F KG + ILERK+A NRLVVDE +NDDN V+ Sbjct: 12 IPFFFSFFFLFSHSFH-----SQSFSKGTKRDFSTAILERKKAPNRLVVDEAVNDDNSVV 66 Query: 450 SFNPETMEKL*LFRKDT 500 + +P+TMEKL LFR DT Sbjct: 67 ALHPDTMEKLQLFRGDT 83 >ref|XP_009773911.1| PREDICTED: cell division control protein 48 homolog D-like [Nicotiana sylvestris] Length = 87 Score = 60.8 bits (146), Expect = 5e-09 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +3 Query: 348 KGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSFNPETMEKL*LFRKDT 500 KG + ILERK++ NRLVVDE +NDDN V++ +P+TMEKL LFR DT Sbjct: 11 KGTKRDYSTAILERKKSPNRLVVDEAINDDNSVVALHPDTMEKLQLFRGDT 61 >ref|XP_010241862.2| PREDICTED: cell division cycle protein 48 homolog [Nelumbo nucifera] Length = 695 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/51 (62%), Positives = 38/51 (74%) Frame = +3 Query: 348 KGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSFNPETMEKL*LFRKDT 500 KG + ILERK++ NRL+VDE +NDDN V+S NPETMEKL LFR DT Sbjct: 11 KGTKRDFSTAILERKKSPNRLIVDEAVNDDNSVVSLNPETMEKLQLFRGDT 61 >gb|EXC16185.1| Cell division cycle protein 48-like protein [Morus notabilis] Length = 791 Score = 65.1 bits (157), Expect = 6e-09 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = +3 Query: 348 KGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSFNPETMEKL*LFRKDT 500 KG + ILERK+A NRLVVDE +NDDN V+S +PETMEKL LFR DT Sbjct: 11 KGTKRDFSTAILERKKAANRLVVDEAVNDDNSVVSLHPETMEKLQLFRGDT 61 >ref|XP_011018733.1| PREDICTED: cell division cycle protein 48 homolog isoform X2 [Populus euphratica] Length = 803 Score = 65.1 bits (157), Expect = 6e-09 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = +3 Query: 348 KGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSFNPETMEKL*LFRKDT 500 KG + ILERK+A NRLVVDE +NDDN V+S +PETMEKL LFR DT Sbjct: 11 KGTKRDFSTAILERKKAPNRLVVDEALNDDNSVVSLHPETMEKLQLFRGDT 61 >ref|XP_024028710.1| cell division cycle protein 48 homolog [Morus notabilis] Length = 805 Score = 65.1 bits (157), Expect = 6e-09 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = +3 Query: 348 KGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSFNPETMEKL*LFRKDT 500 KG + ILERK+A NRLVVDE +NDDN V+S +PETMEKL LFR DT Sbjct: 11 KGTKRDFSTAILERKKAANRLVVDEAVNDDNSVVSLHPETMEKLQLFRGDT 61 >gb|KZV26055.1| Transitional endoplasmic reticulum ATPase [Dorcoceras hygrometricum] Length = 805 Score = 65.1 bits (157), Expect = 6e-09 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = +3 Query: 348 KGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSFNPETMEKL*LFRKDT 500 KG + ILERK+A NRLVVDE +NDDN V+S +PETMEKL LFR DT Sbjct: 11 KGTKRDFSTAILERKKAANRLVVDEAVNDDNSVVSLHPETMEKLQLFRGDT 61 >gb|KVI09510.1| AAA+ ATPase domain-containing protein [Cynara cardunculus var. scolymus] Length = 805 Score = 65.1 bits (157), Expect = 6e-09 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = +3 Query: 348 KGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSFNPETMEKL*LFRKDT 500 KG + ILERK+A NRLVVDE +NDDN V+S +PETMEKL LFR DT Sbjct: 11 KGTKPDFSTAILERKKAANRLVVDEAINDDNSVVSLHPETMEKLQLFRGDT 61 >ref|XP_017246991.1| PREDICTED: cell division control protein 48 homolog E [Daucus carota subsp. sativus] gb|KZM97645.1| hypothetical protein DCAR_014993 [Daucus carota subsp. sativus] Length = 807 Score = 65.1 bits (157), Expect = 6e-09 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = +3 Query: 348 KGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSFNPETMEKL*LFRKDT 500 KG + ILERK+A NRLVVDE +NDDN V+S +PETMEKL LFR DT Sbjct: 11 KGAKRDFSTAILERKKAANRLVVDEAVNDDNSVVSLHPETMEKLQLFRGDT 61