BLASTX nr result
ID: Ophiopogon24_contig00027428
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00027428 (656 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020694921.1| sec1 family domain-containing protein MIP3 [... 58 4e-06 >ref|XP_020694921.1| sec1 family domain-containing protein MIP3 [Dendrobium catenatum] Length = 857 Score = 57.8 bits (138), Expect = 4e-06 Identities = 32/52 (61%), Positives = 33/52 (63%) Frame = +3 Query: 3 FVVGGINTLEAREAMEAVSESSRXXXXXXXXXXXXXXXXXMYDLLLGSSSYI 158 FVVGGIN LE REAMEA+SESSR MYDLLLGSSSYI Sbjct: 806 FVVGGINCLEIREAMEAISESSRPDMELIIGGTTLLIPDDMYDLLLGSSSYI 857