BLASTX nr result
ID: Ophiopogon24_contig00027386
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00027386 (487 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020256094.1| non-specific lipid-transfer protein-like pro... 71 5e-12 ref|XP_020258245.1| non-specific lipid transfer protein GPI-anch... 67 4e-11 ref|XP_020256095.1| non-specific lipid-transfer protein-like pro... 61 2e-08 ref|XP_020275961.1| non-specific lipid-transfer protein-like pro... 60 3e-08 >ref|XP_020256094.1| non-specific lipid-transfer protein-like protein At2g13820 [Asparagus officinalis] Length = 198 Score = 70.9 bits (172), Expect = 5e-12 Identities = 38/91 (41%), Positives = 45/91 (49%) Frame = +1 Query: 1 SNSSTPPPQCCSQLASMVQSQAQCLCTFLNAAPPLPFNINRXXXXXXXXXXXXXXXXXXX 180 SNSSTP PQCC+QLAS+VQ+QAQC+C LN AP LP INR Sbjct: 44 SNSSTPSPQCCTQLASLVQTQAQCMCALLNVAPQLPIPINRTQAITLPGACNIQAPPLSQ 103 Query: 181 XXXXXXXXXXXXXXXFVPGAPTGPFVPGAGS 273 +P P+GP +P AGS Sbjct: 104 CNAPAG----------IPTTPSGPLIPTAGS 124 >ref|XP_020258245.1| non-specific lipid transfer protein GPI-anchored 2-like, partial [Asparagus officinalis] Length = 125 Score = 66.6 bits (161), Expect = 4e-11 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 1 SNSSTPPPQCCSQLASMVQSQAQCLCTFLNAAPPLPFNINR 123 ++SS PPPQCC+QLASMVQSQAQCLC L+ AP LP +NR Sbjct: 45 NSSSNPPPQCCTQLASMVQSQAQCLCQVLSLAPQLPLPVNR 85 >ref|XP_020256095.1| non-specific lipid-transfer protein-like protein At2g13820 [Asparagus officinalis] Length = 197 Score = 61.2 bits (147), Expect = 2e-08 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +1 Query: 4 NSSTPPPQCCSQLASMVQSQAQCLCTFLNAAPPLPFNINR 123 NSS P CC+QLAS+VQ+QAQCLC FLN AP LP IN+ Sbjct: 46 NSSAPSSACCTQLASVVQTQAQCLCVFLNGAPQLPIAINQ 85 >ref|XP_020275961.1| non-specific lipid-transfer protein-like protein At2g13820 [Asparagus officinalis] gb|ONK65026.1| uncharacterized protein A4U43_C07F32700 [Asparagus officinalis] Length = 184 Score = 60.5 bits (145), Expect = 3e-08 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = +1 Query: 1 SNSSTPPPQCCSQLASMVQSQAQCLCTFLNAAPPLPFNIN 120 SNS TP QCC+QL S Q+QAQC+C FLNAAP LP +N Sbjct: 44 SNSLTPSRQCCTQLESFAQTQAQCMCAFLNAAPQLPLPVN 83