BLASTX nr result
ID: Ophiopogon24_contig00027327
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00027327 (499 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020248636.1| translocase of chloroplast 120, chloroplasti... 71 4e-11 >ref|XP_020248636.1| translocase of chloroplast 120, chloroplastic [Asparagus officinalis] gb|ONK57100.1| uncharacterized protein A4U43_C10F16620 [Asparagus officinalis] Length = 1215 Score = 70.9 bits (172), Expect = 4e-11 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = +1 Query: 226 ESFHTPACRHRASDSQELQEAAFDAVVSRDGFDGEDGDNPDREDGNLAGNSN 381 ESF+TPA RH SDSQ+LQEA FD+V S DG DGEDGDN DRE + +SN Sbjct: 78 ESFYTPAYRHMGSDSQDLQEADFDSVESADGVDGEDGDNQDREAKEVVDSSN 129