BLASTX nr result
ID: Ophiopogon24_contig00027210
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00027210 (788 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252754.1| pentatricopeptide repeat-containing protein ... 72 7e-14 >ref|XP_020252754.1| pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Asparagus officinalis] ref|XP_020252755.1| pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Asparagus officinalis] ref|XP_020252756.1| pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Asparagus officinalis] gb|ONK77107.1| uncharacterized protein A4U43_C02F3170 [Asparagus officinalis] Length = 824 Score = 72.4 bits (176), Expect(2) = 7e-14 Identities = 33/56 (58%), Positives = 42/56 (75%) Frame = +3 Query: 222 KPPPIEEGHAIKFLLNNRRNPRTALQYYKSVAMDGFFTLDSFCLLLHIHILVKGGR 389 K PPI E +FLL+N+RNP+TAL+Y+KS DGFF LD FC+LL HIL++ GR Sbjct: 48 KKPPIREHQVTQFLLSNQRNPKTALRYFKSAVKDGFFALDPFCILL--HILIRSGR 101 Score = 33.5 bits (75), Expect(2) = 7e-14 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 2/68 (2%) Frame = +1 Query: 409 ELIMNTVLGISSLKGPGIFDRLVETSKR--ISFSALRLILAVMPIFTNIGANPEAEKAFS 582 EL+ +++L SS + + D+LVETSKR FS R +V+ + G A + Sbjct: 107 ELLKDSLLSDSSPEPSDVVDKLVETSKRCDFDFSHPRSFDSVLVCYARAGRVDNALLVYD 166 Query: 583 SCIRDGIL 606 +R+G++ Sbjct: 167 LMVRNGVI 174