BLASTX nr result
ID: Ophiopogon24_contig00027043
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00027043 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020257944.1| pentatricopeptide repeat-containing protein ... 78 6e-14 >ref|XP_020257944.1| pentatricopeptide repeat-containing protein At5g67570, chloroplastic [Asparagus officinalis] gb|ONK76175.1| uncharacterized protein A4U43_C03F24720 [Asparagus officinalis] Length = 875 Score = 78.2 bits (191), Expect = 6e-14 Identities = 46/77 (59%), Positives = 56/77 (72%), Gaps = 6/77 (7%) Frame = +3 Query: 201 LLHALRKKQTLKSLRRSKKLAQSQP--SAVSGDDESALFETIKAE----*DRLELKGRPW 362 +LHA+RKKQTLK LR+SKK +QSQP S +S DDES LF+TIKAE + +ELKGRPW Sbjct: 46 ILHAVRKKQTLKFLRKSKKRSQSQPQLSPLSNDDESFLFDTIKAEYRAVVEHVELKGRPW 105 Query: 363 ERRKVVGCRFRGVRCGK 413 ER + V RGV G+ Sbjct: 106 ERSRKVD--LRGVERGR 120