BLASTX nr result
ID: Ophiopogon24_contig00027008
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00027008 (501 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK58732.1| uncharacterized protein A4U43_C09F16090 [Asparagu... 61 5e-08 ref|XP_020245453.1| LOW QUALITY PROTEIN: U-box domain-containing... 61 7e-08 >gb|ONK58732.1| uncharacterized protein A4U43_C09F16090 [Asparagus officinalis] Length = 292 Score = 61.2 bits (147), Expect = 5e-08 Identities = 33/67 (49%), Positives = 42/67 (62%), Gaps = 1/67 (1%) Frame = +2 Query: 2 LTPNHLVSSMISQWCSEHGFALPTPC-INHPDNPPIPASKMNSALDGTTITNVSLSTPQC 178 LTPNHLV SMISQWC EH LP P I++PD+PPI AS+ S + + N LS+P Sbjct: 41 LTPNHLVRSMISQWCMEHNIPLPPPSPISNPDDPPISASERTSV--SSLLKN--LSSPSL 96 Query: 179 PAPSTSI 199 P ++ Sbjct: 97 PIKKQAV 103 >ref|XP_020245453.1| LOW QUALITY PROTEIN: U-box domain-containing protein 9-like [Asparagus officinalis] Length = 449 Score = 61.2 bits (147), Expect = 7e-08 Identities = 33/67 (49%), Positives = 42/67 (62%), Gaps = 1/67 (1%) Frame = +2 Query: 2 LTPNHLVSSMISQWCSEHGFALPTPC-INHPDNPPIPASKMNSALDGTTITNVSLSTPQC 178 LTPNHLV SMISQWC EH LP P I++PD+PPI AS+ S + + N LS+P Sbjct: 124 LTPNHLVRSMISQWCMEHNIPLPPPSPISNPDDPPISASERTSV--SSLLKN--LSSPSL 179 Query: 179 PAPSTSI 199 P ++ Sbjct: 180 PIKKQAV 186