BLASTX nr result
ID: Ophiopogon24_contig00026968
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00026968 (401 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79317.1| hypothetical protein VITISV_008344 [Vitis vinifera] 54 9e-07 ref|WP_091224524.1| ribonuclease H [Paenibacillus sp. BC26] >gi|... 54 4e-06 ref|WP_090982637.1| ribonuclease H [Paenibacillus sp. CF384] >gi... 54 4e-06 ref|WP_049931734.1| hypothetical protein [Lachnospiraceae bacter... 54 8e-06 >emb|CAN79317.1| hypothetical protein VITISV_008344 [Vitis vinifera] Length = 118 Score = 54.3 bits (129), Expect = 9e-07 Identities = 23/50 (46%), Positives = 32/50 (64%) Frame = -3 Query: 150 HHDIVQVLQGGMSFFYVVFVGRRPGVYSNWPECNAQVSGYKKAVCQRYNT 1 H D+ +L+ +YVVF GR+ G+Y++WPEC QV GYK V + Y T Sbjct: 17 HVDVKGLLRMANDVYYVVFAGRKKGIYNSWPECQEQVVGYKGNVYKLYKT 66 >ref|WP_091224524.1| ribonuclease H [Paenibacillus sp. BC26] emb|SFT21548.1| ribonuclease HI [Paenibacillus sp. BC26] Length = 219 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -3 Query: 108 FYVVFVGRRPGVYSNWPECNAQVSGYKKAVCQRYNT 1 FYVV+VGR+PGVYSNW EC AQ SG+ A + Y T Sbjct: 6 FYVVWVGRKPGVYSNWSECQAQTSGFDDAKFKSYET 41 >ref|WP_090982637.1| ribonuclease H [Paenibacillus sp. CF384] emb|SDX33509.1| ribonuclease HI [Paenibacillus sp. CF384] Length = 219 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -3 Query: 108 FYVVFVGRRPGVYSNWPECNAQVSGYKKAVCQRYNT 1 FYVV+VGR+PGVYSNW EC AQ SG+ A + Y T Sbjct: 6 FYVVWVGRKPGVYSNWSECQAQTSGFDDAKFKSYET 41 >ref|WP_049931734.1| hypothetical protein [Lachnospiraceae bacterium JC7] gb|ETP73967.1| putative double-stranded RNA/RNA-DNA hybrid binding protein [Lachnospiraceae bacterium JC7] Length = 257 Score = 53.9 bits (128), Expect = 8e-06 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = -3 Query: 117 MSFFYVVFVGRRPGVYSNWPECNAQVSGYKKAVCQRYNT 1 M+FFY V G++PGVYSNW +C AQV GY AV ++++T Sbjct: 1 MAFFYAVQKGKKPGVYSNWNDCKAQVMGYPGAVYKKFST 39