BLASTX nr result
ID: Ophiopogon24_contig00026822
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00026822 (390 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264198.1| rho GDP-dissociation inhibitor 1 [Asparagus ... 60 4e-08 ref|XP_020090539.1| rho GDP-dissociation inhibitor 1-like isofor... 58 2e-07 gb|OAY66335.1| Rho GDP-dissociation inhibitor 1 [Ananas comosus] 58 3e-07 ref|XP_020090538.1| rho GDP-dissociation inhibitor 1-like isofor... 58 3e-07 gb|OAY85202.1| Rho GDP-dissociation inhibitor 1, partial [Ananas... 58 3e-07 ref|XP_009623784.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 56 3e-07 gb|OWM83341.1| hypothetical protein CDL15_Pgr012822 [Punica gran... 56 9e-07 ref|XP_018860124.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 56 1e-06 ref|XP_018860123.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 56 1e-06 ref|XP_010928514.1| PREDICTED: rho GDP-dissociation inhibitor 1 ... 56 1e-06 ref|XP_008795694.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 56 1e-06 gb|KHN03517.1| Rho GDP-dissociation inhibitor 1 [Glycine soja] 56 1e-06 gb|KHN28762.1| Rho GDP-dissociation inhibitor 1 [Glycine soja] 56 1e-06 gb|KRH51157.1| hypothetical protein GLYMA_07G265200 [Glycine max] 56 1e-06 ref|XP_003550475.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 56 1e-06 ref|XP_008807328.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 56 1e-06 ref|XP_020704721.1| rho GDP-dissociation inhibitor 1-like isofor... 55 2e-06 ref|XP_020704719.1| rho GDP-dissociation inhibitor 1-like isofor... 55 2e-06 ref|XP_020110449.1| rho GDP-dissociation inhibitor 1-like [Anana... 55 2e-06 ref|XP_020704718.1| rho GDP-dissociation inhibitor 1-like isofor... 55 2e-06 >ref|XP_020264198.1| rho GDP-dissociation inhibitor 1 [Asparagus officinalis] ref|XP_020264199.1| rho GDP-dissociation inhibitor 1 [Asparagus officinalis] gb|ONK69246.1| uncharacterized protein A4U43_C05F20850 [Asparagus officinalis] Length = 249 Score = 60.1 bits (144), Expect = 4e-08 Identities = 31/39 (79%), Positives = 31/39 (79%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVG 118 IDLGPQ SLR H EKDKD ES RRWKE LL SVDL SVG Sbjct: 69 IDLGPQFSLRQHIEKDKDDESLRRWKEQLLGSVDLNSVG 107 >ref|XP_020090539.1| rho GDP-dissociation inhibitor 1-like isoform X2 [Ananas comosus] Length = 237 Score = 57.8 bits (138), Expect = 2e-07 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVG 118 IDLGPQVSL+ EKDKD ES RRWKE LL SVDL+SVG Sbjct: 76 IDLGPQVSLKEQIEKDKDDESLRRWKEQLLGSVDLSSVG 114 >gb|OAY66335.1| Rho GDP-dissociation inhibitor 1 [Ananas comosus] Length = 249 Score = 57.8 bits (138), Expect = 3e-07 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVG 118 IDLGPQVSL+ EKDKD ES RRWKE LL SVDL+SVG Sbjct: 76 IDLGPQVSLKEQIEKDKDDESLRRWKEQLLGSVDLSSVG 114 >ref|XP_020090538.1| rho GDP-dissociation inhibitor 1-like isoform X1 [Ananas comosus] Length = 256 Score = 57.8 bits (138), Expect = 3e-07 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVG 118 IDLGPQVSL+ EKDKD ES RRWKE LL SVDL+SVG Sbjct: 76 IDLGPQVSLKEQIEKDKDDESLRRWKEQLLGSVDLSSVG 114 >gb|OAY85202.1| Rho GDP-dissociation inhibitor 1, partial [Ananas comosus] Length = 293 Score = 57.8 bits (138), Expect = 3e-07 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVG 118 IDLGPQVSL+ EKDKD ES RRWKE LL SVDL+SVG Sbjct: 113 IDLGPQVSLKEQIEKDKDDESLRRWKEQLLGSVDLSSVG 151 >ref|XP_009623784.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Nicotiana tomentosiformis] Length = 141 Score = 55.8 bits (133), Expect = 3e-07 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVGGWIATSS 139 I+LGPQ +L+ EKDKD ES RRWKE LL SVD+ +VGG I SS Sbjct: 86 IELGPQCTLKEQFEKDKDDESLRRWKEQLLGSVDINAVGGNIVLSS 131 >gb|OWM83341.1| hypothetical protein CDL15_Pgr012822 [Punica granatum] gb|PKI66406.1| hypothetical protein CRG98_013208 [Punica granatum] Length = 237 Score = 56.2 bits (134), Expect = 9e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVG 118 IDLGPQ +L+ H EKDKD ES RRWKE LL SVD +SVG Sbjct: 58 IDLGPQCTLKEHFEKDKDDESLRRWKEQLLGSVDFSSVG 96 >ref|XP_018860124.1| PREDICTED: rho GDP-dissociation inhibitor 1-like isoform X2 [Juglans regia] Length = 251 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVG 118 +DLGPQVSL+ EKDKD ES R+WKE LL SVDL+SVG Sbjct: 72 LDLGPQVSLKEQLEKDKDDESLRKWKEQLLGSVDLSSVG 110 >ref|XP_018860123.1| PREDICTED: rho GDP-dissociation inhibitor 1-like isoform X1 [Juglans regia] Length = 252 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVG 118 +DLGPQVSL+ EKDKD ES R+WKE LL SVDL+SVG Sbjct: 72 LDLGPQVSLKEQLEKDKDDESLRKWKEQLLGSVDLSSVG 110 >ref|XP_010928514.1| PREDICTED: rho GDP-dissociation inhibitor 1 [Elaeis guineensis] Length = 261 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVG 118 IDLGP+VSL+ EKDKD ES RRWKE LL SVDL+SVG Sbjct: 81 IDLGPKVSLKDQLEKDKDDESLRRWKEQLLGSVDLSSVG 119 >ref|XP_008795694.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Phoenix dactylifera] Length = 262 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVG 118 IDLGP+VSL+ EKDKD ES RRWKE LL SVDL+SVG Sbjct: 82 IDLGPKVSLKDQLEKDKDDESLRRWKEQLLGSVDLSSVG 120 >gb|KHN03517.1| Rho GDP-dissociation inhibitor 1 [Glycine soja] Length = 235 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVG 118 IDLGPQ +L+ EKDKD ES RRWKE LL SVD+TSVG Sbjct: 59 IDLGPQCTLKEQLEKDKDDESLRRWKEQLLGSVDMTSVG 97 >gb|KHN28762.1| Rho GDP-dissociation inhibitor 1 [Glycine soja] Length = 236 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVG 118 IDLGPQ +L+ EKDKD ES RRWKE LL SVD+TSVG Sbjct: 60 IDLGPQCTLKEQLEKDKDDESLRRWKEQLLGSVDMTSVG 98 >gb|KRH51157.1| hypothetical protein GLYMA_07G265200 [Glycine max] Length = 249 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVG 118 IDLGPQ +L+ EKDKD ES RRWKE LL SVD+TSVG Sbjct: 73 IDLGPQCTLKEQLEKDKDDESLRRWKEQLLGSVDMTSVG 111 >ref|XP_003550475.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Glycine max] gb|KRH01997.1| hypothetical protein GLYMA_17G008800 [Glycine max] Length = 249 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVG 118 IDLGPQ +L+ EKDKD ES RRWKE LL SVD+TSVG Sbjct: 73 IDLGPQCTLKEQLEKDKDDESLRRWKEQLLGSVDMTSVG 111 >ref|XP_008807328.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Phoenix dactylifera] Length = 263 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVG 118 IDLGP++SL+ EKDKD ES RRWKE LL SVDL+SVG Sbjct: 83 IDLGPKLSLKVQLEKDKDDESLRRWKEQLLGSVDLSSVG 121 >ref|XP_020704721.1| rho GDP-dissociation inhibitor 1-like isoform X3 [Dendrobium catenatum] Length = 234 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVG 118 +DLGPQV+L+ EKDKD ES RRWKE LL SVDL SVG Sbjct: 70 LDLGPQVTLKDQLEKDKDDESLRRWKEQLLGSVDLNSVG 108 >ref|XP_020704719.1| rho GDP-dissociation inhibitor 1-like isoform X2 [Dendrobium catenatum] ref|XP_020704720.1| rho GDP-dissociation inhibitor 1-like isoform X2 [Dendrobium catenatum] Length = 241 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVG 118 +DLGPQV+L+ EKDKD ES RRWKE LL SVDL SVG Sbjct: 56 LDLGPQVTLKDQLEKDKDDESLRRWKEQLLGSVDLNSVG 94 >ref|XP_020110449.1| rho GDP-dissociation inhibitor 1-like [Ananas comosus] gb|OAY63266.1| Rho GDP-dissociation inhibitor 1 [Ananas comosus] Length = 241 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVG 118 IDLGP+VS++ EKDKD ES RRWKE LL SVDL+SVG Sbjct: 61 IDLGPRVSIKDQLEKDKDDESLRRWKEQLLGSVDLSSVG 99 >ref|XP_020704718.1| rho GDP-dissociation inhibitor 1-like isoform X1 [Dendrobium catenatum] Length = 255 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +2 Query: 2 IDLGPQVSLRYHREKDKDVESFRRWKE*LL*SVDLTSVG 118 +DLGPQV+L+ EKDKD ES RRWKE LL SVDL SVG Sbjct: 70 LDLGPQVTLKDQLEKDKDDESLRRWKEQLLGSVDLNSVG 108