BLASTX nr result
ID: Ophiopogon24_contig00026798
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00026798 (362 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020256271.1| CRAL-TRIO domain-containing protein C23B6.04... 79 4e-15 ref|XP_020256270.1| phosphatidylinositol transfer protein PDR16-... 79 5e-15 ref|XP_020256269.1| random slug protein 5-like isoform X1 [Aspar... 79 5e-15 gb|ONK74497.1| uncharacterized protein A4U43_C03F6980 [Asparagus... 79 1e-14 >ref|XP_020256271.1| CRAL-TRIO domain-containing protein C23B6.04c-like isoform X3 [Asparagus officinalis] Length = 285 Score = 79.0 bits (193), Expect = 4e-15 Identities = 40/56 (71%), Positives = 47/56 (83%), Gaps = 1/56 (1%) Frame = -2 Query: 361 NNIEYNHEEFSIMMNKDETRS-ASLTELDEKLTLTAHENSPLEAASEPPLVLTQAS 197 N IEYNHE++S +MNKDET+S A + EL+EKLTLT +E PLEAASE PLVLTQAS Sbjct: 230 NKIEYNHEDYSALMNKDETKSTAIMRELEEKLTLTTNEKCPLEAASETPLVLTQAS 285 >ref|XP_020256270.1| phosphatidylinositol transfer protein PDR16-like isoform X2 [Asparagus officinalis] Length = 296 Score = 79.0 bits (193), Expect = 5e-15 Identities = 40/56 (71%), Positives = 47/56 (83%), Gaps = 1/56 (1%) Frame = -2 Query: 361 NNIEYNHEEFSIMMNKDETRS-ASLTELDEKLTLTAHENSPLEAASEPPLVLTQAS 197 N IEYNHE++S +MNKDET+S A + EL+EKLTLT +E PLEAASE PLVLTQAS Sbjct: 241 NKIEYNHEDYSALMNKDETKSTAIMRELEEKLTLTTNEKCPLEAASETPLVLTQAS 296 >ref|XP_020256269.1| random slug protein 5-like isoform X1 [Asparagus officinalis] Length = 297 Score = 79.0 bits (193), Expect = 5e-15 Identities = 40/56 (71%), Positives = 47/56 (83%), Gaps = 1/56 (1%) Frame = -2 Query: 361 NNIEYNHEEFSIMMNKDETRS-ASLTELDEKLTLTAHENSPLEAASEPPLVLTQAS 197 N IEYNHE++S +MNKDET+S A + EL+EKLTLT +E PLEAASE PLVLTQAS Sbjct: 242 NKIEYNHEDYSALMNKDETKSTAIMRELEEKLTLTTNEKCPLEAASETPLVLTQAS 297 >gb|ONK74497.1| uncharacterized protein A4U43_C03F6980 [Asparagus officinalis] Length = 781 Score = 79.0 bits (193), Expect = 1e-14 Identities = 40/56 (71%), Positives = 47/56 (83%), Gaps = 1/56 (1%) Frame = -2 Query: 361 NNIEYNHEEFSIMMNKDETRS-ASLTELDEKLTLTAHENSPLEAASEPPLVLTQAS 197 N IEYNHE++S +MNKDET+S A + EL+EKLTLT +E PLEAASE PLVLTQAS Sbjct: 726 NKIEYNHEDYSALMNKDETKSTAIMRELEEKLTLTTNEKCPLEAASETPLVLTQAS 781