BLASTX nr result
ID: Ophiopogon24_contig00026783
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00026783 (493 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK71108.1| uncharacterized protein A4U43_C04F4800 [Asparagus... 74 8e-13 ref|XP_020262243.1| pentatricopeptide repeat-containing protein ... 74 2e-12 ref|XP_020260192.1| pentatricopeptide repeat-containing protein ... 74 3e-12 ref|XP_008806452.2| PREDICTED: pentatricopeptide repeat-containi... 71 2e-11 ref|XP_019702580.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-11 ref|XP_009390938.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-10 gb|KMT13678.1| hypothetical protein BVRB_4g080610 [Beta vulgaris... 65 3e-09 ref|XP_019104265.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-09 gb|KZN04584.1| hypothetical protein DCAR_005421 [Daucus carota s... 65 3e-09 ref|XP_017232539.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-09 ref|XP_015062415.1| PREDICTED: pentatricopeptide repeat-containi... 65 5e-09 ref|XP_010248027.1| PREDICTED: pentatricopeptide repeat-containi... 64 6e-09 gb|PKA61236.1| Pentatricopeptide repeat-containing protein [Apos... 64 8e-09 gb|KNA06921.1| hypothetical protein SOVF_176610, partial [Spinac... 64 9e-09 ref|XP_021857487.1| pentatricopeptide repeat-containing protein ... 64 9e-09 ref|XP_006344758.1| PREDICTED: pentatricopeptide repeat-containi... 63 2e-08 ref|XP_004231292.1| PREDICTED: pentatricopeptide repeat-containi... 63 2e-08 ref|XP_021772412.1| pentatricopeptide repeat-containing protein ... 63 2e-08 gb|PIA64146.1| hypothetical protein AQUCO_00201438v1 [Aquilegia ... 63 2e-08 gb|OAP17975.1| hypothetical protein AXX17_AT1G09820 [Arabidopsis... 63 2e-08 >gb|ONK71108.1| uncharacterized protein A4U43_C04F4800 [Asparagus officinalis] Length = 252 Score = 73.9 bits (180), Expect = 8e-13 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHLCNSAS 378 MLEKGLVPN VTYDIIKDGMV++GFVPDIDGHL NSAS Sbjct: 215 MLEKGLVPNNVTYDIIKDGMVEKGFVPDIDGHLSNSAS 252 >ref|XP_020262243.1| pentatricopeptide repeat-containing protein At1g09820-like [Asparagus officinalis] Length = 314 Score = 73.9 bits (180), Expect = 2e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHLCNSAS 378 MLEKGLVPN VTYDIIKDGMV++GFVPDIDGHL NSAS Sbjct: 277 MLEKGLVPNNVTYDIIKDGMVEKGFVPDIDGHLSNSAS 314 >ref|XP_020260192.1| pentatricopeptide repeat-containing protein At1g09820 [Asparagus officinalis] ref|XP_020260193.1| pentatricopeptide repeat-containing protein At1g09820 [Asparagus officinalis] ref|XP_020260194.1| pentatricopeptide repeat-containing protein At1g09820 [Asparagus officinalis] Length = 532 Score = 73.9 bits (180), Expect = 3e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHLCNSAS 378 MLEKGLVPN VTYDIIKDGMV++GFVPDIDGHL NSAS Sbjct: 495 MLEKGLVPNNVTYDIIKDGMVEKGFVPDIDGHLSNSAS 532 >ref|XP_008806452.2| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 [Phoenix dactylifera] Length = 586 Score = 71.2 bits (173), Expect = 2e-11 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHLCNSAS 378 MLEKGLVPN+VTYDIIK+ MV+RG++PDIDGHLCN A+ Sbjct: 549 MLEKGLVPNRVTYDIIKEDMVERGYIPDIDGHLCNDAA 586 >ref|XP_019702580.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 [Elaeis guineensis] Length = 592 Score = 70.9 bits (172), Expect = 3e-11 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHLCNSAS 378 MLEKGLVPN+VTYDIIK+ MV+RG++PDIDGHLCN A+ Sbjct: 555 MLEKGLVPNRVTYDIIKEEMVERGYIPDIDGHLCNDAA 592 >ref|XP_009390938.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like [Musa acuminata subsp. malaccensis] ref|XP_018678867.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like [Musa acuminata subsp. malaccensis] Length = 614 Score = 68.6 bits (166), Expect = 2e-10 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHLCNSAS 378 MLEKGLVPN+VTY++IKD M++RG+VP IDGHLCN+AS Sbjct: 577 MLEKGLVPNRVTYNMIKDEMIERGYVPSIDGHLCNNAS 614 >gb|KMT13678.1| hypothetical protein BVRB_4g080610 [Beta vulgaris subsp. vulgaris] Length = 616 Score = 65.5 bits (158), Expect = 3e-09 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHLCNSAS 378 MLEKGLVPN++TYDIIK+ M+++GFVPDIDGHL N +S Sbjct: 577 MLEKGLVPNRITYDIIKEEMMEKGFVPDIDGHLYNQSS 614 >ref|XP_019104265.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06920 [Beta vulgaris subsp. vulgaris] Length = 1238 Score = 65.5 bits (158), Expect = 3e-09 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHLCNSAS 378 MLEKGLVPN++TYDIIK+ M+++GFVPDIDGHL N +S Sbjct: 577 MLEKGLVPNRITYDIIKEEMMEKGFVPDIDGHLYNQSS 614 >gb|KZN04584.1| hypothetical protein DCAR_005421 [Daucus carota subsp. sativus] Length = 449 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/37 (70%), Positives = 35/37 (94%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHLCNSA 381 MLEKGL+PNKVTYDI+++GM+++GFVPDIDGH+ S+ Sbjct: 410 MLEKGLIPNKVTYDIVREGMMEKGFVPDIDGHIYTSS 446 >ref|XP_017232539.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 [Daucus carota subsp. sativus] Length = 610 Score = 65.1 bits (157), Expect = 3e-09 Identities = 26/37 (70%), Positives = 35/37 (94%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHLCNSA 381 MLEKGL+PNKVTYDI+++GM+++GFVPDIDGH+ S+ Sbjct: 571 MLEKGLIPNKVTYDIVREGMMEKGFVPDIDGHIYTSS 607 >ref|XP_015062415.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 [Solanum pennellii] ref|XP_015062421.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 [Solanum pennellii] ref|XP_015062430.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 [Solanum pennellii] Length = 605 Score = 64.7 bits (156), Expect = 5e-09 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHLCN 387 MLEKGLVPN++TYDII++ M+D+GFVPDIDGHL N Sbjct: 566 MLEKGLVPNRITYDIIREEMIDKGFVPDIDGHLYN 600 >ref|XP_010248027.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 [Nelumbo nucifera] Length = 616 Score = 64.3 bits (155), Expect = 6e-09 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHLCNSA 381 MLEKGL+PN++TY+I++ MVD GFVPDIDGHLC+ A Sbjct: 577 MLEKGLIPNRITYEIVRGEMVDSGFVPDIDGHLCSGA 613 >gb|PKA61236.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 524 Score = 63.9 bits (154), Expect = 8e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHLCNSAS 378 MLEKGLVPN+ TYD+IKD M++RGFVP I+GHLC+S S Sbjct: 487 MLEKGLVPNRYTYDMIKDKMLNRGFVPSIEGHLCHSFS 524 >gb|KNA06921.1| hypothetical protein SOVF_176610, partial [Spinacia oleracea] Length = 585 Score = 63.9 bits (154), Expect = 9e-09 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHLCNSAS 378 MLEKGLVPN++TYDIIK+ M+++GF PDIDGHL N +S Sbjct: 546 MLEKGLVPNRITYDIIKEEMMEKGFAPDIDGHLYNQSS 583 >ref|XP_021857487.1| pentatricopeptide repeat-containing protein At1g09820 [Spinacia oleracea] Length = 620 Score = 63.9 bits (154), Expect = 9e-09 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHLCNSAS 378 MLEKGLVPN++TYDIIK+ M+++GF PDIDGHL N +S Sbjct: 581 MLEKGLVPNRITYDIIKEEMMEKGFAPDIDGHLYNQSS 618 >ref|XP_006344758.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 [Solanum tuberosum] ref|XP_006344759.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 [Solanum tuberosum] Length = 605 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHL 393 MLEKGLVPN++TYDII++ M+D+GFVPDIDGHL Sbjct: 566 MLEKGLVPNRITYDIIREEMIDKGFVPDIDGHL 598 >ref|XP_004231292.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 [Solanum lycopersicum] ref|XP_010313517.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 [Solanum lycopersicum] Length = 605 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHL 393 MLEKGLVPN++TYDII++ M+D+GFVPDIDGHL Sbjct: 566 MLEKGLVPNRITYDIIREEMIDKGFVPDIDGHL 598 >ref|XP_021772412.1| pentatricopeptide repeat-containing protein At1g09820-like [Chenopodium quinoa] Length = 620 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHLCNSAS 378 MLEKGLVPN++TYDIIK+ M+++GF PDIDGHL N +S Sbjct: 581 MLEKGLVPNRITYDIIKEEMMEKGFSPDIDGHLYNQSS 618 >gb|PIA64146.1| hypothetical protein AQUCO_00201438v1 [Aquilegia coerulea] Length = 623 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHL 393 MLEKGLVPN++TYDI++D MV++GFVPDIDGHL Sbjct: 587 MLEKGLVPNRITYDIVRDEMVEKGFVPDIDGHL 619 >gb|OAP17975.1| hypothetical protein AXX17_AT1G09820 [Arabidopsis thaliana] Length = 606 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/35 (74%), Positives = 33/35 (94%) Frame = -3 Query: 491 MLEKGLVPNKVTYDIIKDGMVDRGFVPDIDGHLCN 387 MLEKGLVPN++TY+I+K+ MVD+GFVPDI+GHL N Sbjct: 567 MLEKGLVPNRITYEIVKEEMVDKGFVPDIEGHLFN 601