BLASTX nr result
ID: Ophiopogon24_contig00026770
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00026770 (354 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020251408.1| CTP synthase-like isoform X5 [Asparagus offi... 92 3e-19 ref|XP_020251407.1| CTP synthase-like isoform X4 [Asparagus offi... 92 3e-19 ref|XP_020251406.1| CTP synthase-like isoform X3 [Asparagus offi... 92 3e-19 ref|XP_020251404.1| CTP synthase-like isoform X2 [Asparagus offi... 92 4e-19 ref|XP_020251403.1| CTP synthase-like isoform X1 [Asparagus offi... 92 4e-19 ref|XP_015865757.1| PREDICTED: CTP synthase-like, partial [Zizip... 87 2e-17 ref|XP_019709507.1| PREDICTED: CTP synthase 1 isoform X3 [Elaeis... 86 3e-17 ref|XP_010913365.1| PREDICTED: CTP synthase isoform X2 [Elaeis g... 86 3e-17 ref|XP_017697254.1| PREDICTED: CTP synthase [Phoenix dactylifera] 86 3e-17 ref|XP_010913356.1| PREDICTED: CTP synthase isoform X1 [Elaeis g... 86 3e-17 gb|PKA61041.1| CTP synthase [Apostasia shenzhenica] 86 4e-17 ref|XP_010915634.1| PREDICTED: CTP synthase [Elaeis guineensis] 86 4e-17 ref|XP_008798436.1| PREDICTED: CTP synthase isoform X5 [Phoenix ... 86 4e-17 ref|XP_008798435.1| PREDICTED: CTP synthase isoform X4 [Phoenix ... 86 4e-17 ref|XP_008798434.1| PREDICTED: CTP synthase isoform X3 [Phoenix ... 86 4e-17 ref|XP_008798433.1| PREDICTED: CTP synthase isoform X2 [Phoenix ... 86 4e-17 ref|XP_008798430.1| PREDICTED: CTP synthase isoform X1 [Phoenix ... 86 4e-17 ref|XP_023003630.1| CTP synthase-like [Cucurbita maxima] 84 1e-16 ref|XP_022926543.1| CTP synthase-like [Cucurbita moschata] 84 1e-16 ref|XP_021608287.1| CTP synthase-like [Manihot esculenta] >gi|12... 84 1e-16 >ref|XP_020251408.1| CTP synthase-like isoform X5 [Asparagus officinalis] Length = 461 Score = 91.7 bits (226), Expect = 3e-19 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = +3 Query: 3 GLNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 GLNL GVA EP L+EWT RAEICD+LQNPVRIAMVGKYTGLSDSYLSVLK Sbjct: 269 GLNLHGVAVEPMLEEWTARAEICDTLQNPVRIAMVGKYTGLSDSYLSVLK 318 >ref|XP_020251407.1| CTP synthase-like isoform X4 [Asparagus officinalis] Length = 465 Score = 91.7 bits (226), Expect = 3e-19 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = +3 Query: 3 GLNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 GLNL GVA EP L+EWT RAEICD+LQNPVRIAMVGKYTGLSDSYLSVLK Sbjct: 269 GLNLHGVAVEPMLEEWTARAEICDTLQNPVRIAMVGKYTGLSDSYLSVLK 318 >ref|XP_020251406.1| CTP synthase-like isoform X3 [Asparagus officinalis] Length = 466 Score = 91.7 bits (226), Expect = 3e-19 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = +3 Query: 3 GLNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 GLNL GVA EP L+EWT RAEICD+LQNPVRIAMVGKYTGLSDSYLSVLK Sbjct: 269 GLNLHGVAVEPMLEEWTARAEICDTLQNPVRIAMVGKYTGLSDSYLSVLK 318 >ref|XP_020251404.1| CTP synthase-like isoform X2 [Asparagus officinalis] Length = 511 Score = 91.7 bits (226), Expect = 4e-19 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = +3 Query: 3 GLNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 GLNL GVA EP L+EWT RAEICD+LQNPVRIAMVGKYTGLSDSYLSVLK Sbjct: 269 GLNLHGVAVEPMLEEWTARAEICDTLQNPVRIAMVGKYTGLSDSYLSVLK 318 >ref|XP_020251403.1| CTP synthase-like isoform X1 [Asparagus officinalis] gb|ONK81144.1| uncharacterized protein A4U43_C01F25760 [Asparagus officinalis] Length = 595 Score = 91.7 bits (226), Expect = 4e-19 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = +3 Query: 3 GLNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 GLNL GVA EP L+EWT RAEICD+LQNPVRIAMVGKYTGLSDSYLSVLK Sbjct: 269 GLNLHGVAVEPMLEEWTARAEICDTLQNPVRIAMVGKYTGLSDSYLSVLK 318 >ref|XP_015865757.1| PREDICTED: CTP synthase-like, partial [Ziziphus jujuba] Length = 545 Score = 86.7 bits (213), Expect = 2e-17 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = +3 Query: 6 LNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 LNLQ VAGEP L+EWT+RAEICD++ PVRIAMVGKYTGLSDSYLSVLK Sbjct: 204 LNLQSVAGEPDLEEWTSRAEICDTVLEPVRIAMVGKYTGLSDSYLSVLK 252 >ref|XP_019709507.1| PREDICTED: CTP synthase 1 isoform X3 [Elaeis guineensis] Length = 568 Score = 86.3 bits (212), Expect = 3e-17 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = +3 Query: 6 LNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 LNLQGVA EP L EWT RAE+CDSL +PVRIAMVGKYTGLSDSYLSVLK Sbjct: 237 LNLQGVAREPNLVEWTDRAELCDSLHDPVRIAMVGKYTGLSDSYLSVLK 285 >ref|XP_010913365.1| PREDICTED: CTP synthase isoform X2 [Elaeis guineensis] Length = 601 Score = 86.3 bits (212), Expect = 3e-17 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = +3 Query: 6 LNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 LNLQGVA EP L EWT RAE+CDSL +PVRIAMVGKYTGLSDSYLSVLK Sbjct: 270 LNLQGVAREPNLVEWTDRAELCDSLHDPVRIAMVGKYTGLSDSYLSVLK 318 >ref|XP_017697254.1| PREDICTED: CTP synthase [Phoenix dactylifera] Length = 605 Score = 86.3 bits (212), Expect = 3e-17 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = +3 Query: 6 LNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 L+L GVAGEPKLDEW +RAEICD+L PVRIAMVGKYTGL DSYLSVLK Sbjct: 270 LDLLGVAGEPKLDEWVSRAEICDTLHEPVRIAMVGKYTGLPDSYLSVLK 318 >ref|XP_010913356.1| PREDICTED: CTP synthase isoform X1 [Elaeis guineensis] Length = 617 Score = 86.3 bits (212), Expect = 3e-17 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = +3 Query: 6 LNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 LNLQGVA EP L EWT RAE+CDSL +PVRIAMVGKYTGLSDSYLSVLK Sbjct: 286 LNLQGVAREPNLVEWTDRAELCDSLHDPVRIAMVGKYTGLSDSYLSVLK 334 >gb|PKA61041.1| CTP synthase [Apostasia shenzhenica] Length = 573 Score = 85.9 bits (211), Expect = 4e-17 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = +3 Query: 6 LNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 LNLQG+ EP LDEWT+RA+ICD+L++PVRIAMVGKYTGLSDSYLSVLK Sbjct: 242 LNLQGITREPILDEWTSRAKICDALRDPVRIAMVGKYTGLSDSYLSVLK 290 >ref|XP_010915634.1| PREDICTED: CTP synthase [Elaeis guineensis] Length = 605 Score = 85.9 bits (211), Expect = 4e-17 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = +3 Query: 6 LNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 L+L G+AGEPKLDEW +RAEICD+L PVRIAMVGKYTGL DSYLSVLK Sbjct: 270 LDLLGIAGEPKLDEWVSRAEICDTLHEPVRIAMVGKYTGLPDSYLSVLK 318 >ref|XP_008798436.1| PREDICTED: CTP synthase isoform X5 [Phoenix dactylifera] Length = 609 Score = 85.9 bits (211), Expect = 4e-17 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = +3 Query: 6 LNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 LNLQGVA EP LDEWT RA++CDSL +PVRIAMVGKYTGLSDSYLSV K Sbjct: 270 LNLQGVAREPDLDEWTNRAKLCDSLHDPVRIAMVGKYTGLSDSYLSVWK 318 >ref|XP_008798435.1| PREDICTED: CTP synthase isoform X4 [Phoenix dactylifera] Length = 611 Score = 85.9 bits (211), Expect = 4e-17 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = +3 Query: 6 LNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 LNLQGVA EP LDEWT RA++CDSL +PVRIAMVGKYTGLSDSYLSV K Sbjct: 270 LNLQGVAREPDLDEWTNRAKLCDSLHDPVRIAMVGKYTGLSDSYLSVWK 318 >ref|XP_008798434.1| PREDICTED: CTP synthase isoform X3 [Phoenix dactylifera] Length = 625 Score = 85.9 bits (211), Expect = 4e-17 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = +3 Query: 6 LNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 LNLQGVA EP LDEWT RA++CDSL +PVRIAMVGKYTGLSDSYLSV K Sbjct: 284 LNLQGVAREPDLDEWTNRAKLCDSLHDPVRIAMVGKYTGLSDSYLSVWK 332 >ref|XP_008798433.1| PREDICTED: CTP synthase isoform X2 [Phoenix dactylifera] Length = 625 Score = 85.9 bits (211), Expect = 4e-17 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = +3 Query: 6 LNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 LNLQGVA EP LDEWT RA++CDSL +PVRIAMVGKYTGLSDSYLSV K Sbjct: 286 LNLQGVAREPDLDEWTNRAKLCDSLHDPVRIAMVGKYTGLSDSYLSVWK 334 >ref|XP_008798430.1| PREDICTED: CTP synthase isoform X1 [Phoenix dactylifera] Length = 627 Score = 85.9 bits (211), Expect = 4e-17 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = +3 Query: 6 LNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 LNLQGVA EP LDEWT RA++CDSL +PVRIAMVGKYTGLSDSYLSV K Sbjct: 286 LNLQGVAREPDLDEWTNRAKLCDSLHDPVRIAMVGKYTGLSDSYLSVWK 334 >ref|XP_023003630.1| CTP synthase-like [Cucurbita maxima] Length = 602 Score = 84.3 bits (207), Expect = 1e-16 Identities = 40/49 (81%), Positives = 42/49 (85%) Frame = +3 Query: 6 LNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 LNL +AG P L+EWT RAEICDSL PVRIAMVGKYTGLSDSYLSVLK Sbjct: 270 LNLHSIAGGPALEEWTARAEICDSLHEPVRIAMVGKYTGLSDSYLSVLK 318 >ref|XP_022926543.1| CTP synthase-like [Cucurbita moschata] Length = 602 Score = 84.3 bits (207), Expect = 1e-16 Identities = 40/49 (81%), Positives = 42/49 (85%) Frame = +3 Query: 6 LNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 LNL +AG P L+EWT RAEICDSL PVRIAMVGKYTGLSDSYLSVLK Sbjct: 270 LNLHSIAGGPALEEWTARAEICDSLHEPVRIAMVGKYTGLSDSYLSVLK 318 >ref|XP_021608287.1| CTP synthase-like [Manihot esculenta] ref|XP_021608288.1| CTP synthase-like [Manihot esculenta] ref|XP_021608289.1| CTP synthase-like [Manihot esculenta] gb|OAY54455.1| hypothetical protein MANES_03G076400 [Manihot esculenta] gb|OAY54456.1| hypothetical protein MANES_03G076400 [Manihot esculenta] Length = 605 Score = 84.3 bits (207), Expect = 1e-16 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = +3 Query: 3 GLNLQGVAGEPKLDEWTTRAEICDSLQNPVRIAMVGKYTGLSDSYLSVLK 152 GLNLQG+A EP L EWT R ++CD L +PVRIAMVGKYTGLSDSYLSVLK Sbjct: 269 GLNLQGIATEPDLHEWTARTKVCDMLHDPVRIAMVGKYTGLSDSYLSVLK 318