BLASTX nr result
ID: Ophiopogon24_contig00026525
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00026525 (415 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020256228.1| DExH-box ATP-dependent RNA helicase DExH6 [A... 84 6e-16 >ref|XP_020256228.1| DExH-box ATP-dependent RNA helicase DExH6 [Asparagus officinalis] gb|ONK74446.1| uncharacterized protein A4U43_C03F6330 [Asparagus officinalis] Length = 1215 Score = 83.6 bits (205), Expect = 6e-16 Identities = 47/94 (50%), Positives = 54/94 (57%), Gaps = 1/94 (1%) Frame = +3 Query: 51 GRKGLGFVTPGGFLRTLMSDSARMAPSHSHRFSGSMPNGPQ-RRFQNQKPRNKSQFLPHG 227 GRKG ++ P GFLR+LMSD+ R SHSH G +PNGPQ +RFQ Q PRN+S Sbjct: 1128 GRKGSAYIPPNGFLRSLMSDNNRATTSHSHMGRGPIPNGPQPKRFQQQNPRNES------ 1181 Query: 228 PGTNATAXXXXXXXXXXXXTLMNKSSKRRRPGKG 329 P T A A T N SSKRR PGKG Sbjct: 1182 PKTKAAAASSGNGGFGNGGTPKNNSSKRRWPGKG 1215