BLASTX nr result
ID: Ophiopogon24_contig00026271
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00026271 (1045 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020258748.1| uncharacterized protein LOC109835170 [Aspara... 62 2e-07 >ref|XP_020258748.1| uncharacterized protein LOC109835170 [Asparagus officinalis] gb|ONK75941.1| uncharacterized protein A4U43_C03F22180 [Asparagus officinalis] Length = 239 Score = 62.4 bits (150), Expect = 2e-07 Identities = 32/64 (50%), Positives = 43/64 (67%) Frame = +3 Query: 231 MGCCLSKRTEEDSISTKAKAKAKGEKYNPVGSGSRDPPPTESPHDEEKVKEVLSETPKFS 410 MG C SK+ ++ S + GEK P+ RDPPPTESP +EEKVKEVLSETPK + Sbjct: 1 MGVCFSKKKKKRS----KDSVGSGEKSKPI-QDCRDPPPTESPQEEEKVKEVLSETPKLA 55 Query: 411 SIQT 422 ++++ Sbjct: 56 AVRS 59