BLASTX nr result
ID: Ophiopogon24_contig00025989
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00025989 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KUM45861.1| hypothetical protein ABT39_MTgene2215 (mitochondr... 87 5e-20 gb|KUM45860.1| hypothetical protein ABT39_MTgene2214 (mitochondr... 65 5e-11 ref|YP_009045721.1| orf127b (mitochondrion) [Batis maritima] >gi... 58 7e-08 >gb|KUM45861.1| hypothetical protein ABT39_MTgene2215 (mitochondrion) [Picea glauca] Length = 46 Score = 87.0 bits (214), Expect = 5e-20 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = +1 Query: 223 MHGRIGVADQEPADQSQTAVTLSHPGTTRRGPGISAPLGQGSTDQI 360 MH +I VADQEPADQSQTAV LSHPGTTRRGPGISAPLGQGSTDQI Sbjct: 1 MHRKIEVADQEPADQSQTAVRLSHPGTTRRGPGISAPLGQGSTDQI 46 >gb|KUM45860.1| hypothetical protein ABT39_MTgene2214 (mitochondrion) [Picea glauca] Length = 79 Score = 65.1 bits (157), Expect = 5e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 133 MHLTDREDYVEWYASVSTGPILPPHMRIGS 44 MHLTDREDYVEW ASVSTGPILPPHMRIGS Sbjct: 1 MHLTDREDYVEWSASVSTGPILPPHMRIGS 30 >ref|YP_009045721.1| orf127b (mitochondrion) [Batis maritima] gb|AIC83324.1| orf127b (mitochondrion) [Batis maritima] Length = 127 Score = 58.2 bits (139), Expect = 7e-08 Identities = 36/66 (54%), Positives = 38/66 (57%) Frame = +1 Query: 265 QSQTAVTLSHPGTTRRGPGISAPLGQGSTDQI*LDXXXXXXXXXXXXXXGDLHPHSINRS 444 Q QTAVTLSHPGTTRR P +S + I D GDLHPHSINRS Sbjct: 16 QFQTAVTLSHPGTTRRDP-VSPTRAREYRSDIATDSSSLRPISKRPP--GDLHPHSINRS 72 Query: 445 STQTKK 462 STQTKK Sbjct: 73 STQTKK 78