BLASTX nr result
ID: Ophiopogon24_contig00025723
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00025723 (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020101029.1| probable tyrosine-protein phosphatase At1g05... 54 8e-06 >ref|XP_020101029.1| probable tyrosine-protein phosphatase At1g05000 isoform X2 [Ananas comosus] Length = 243 Score = 53.5 bits (127), Expect = 8e-06 Identities = 28/54 (51%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Frame = -3 Query: 382 VPALRCCQGTGFRSKVHGAIRHLELETFINFIFKFTDLLK-VKKFVSGGLLFFI 224 VPA RC +G FRSKVH A+RHL+ +TFI IF L+ + K VS L FI Sbjct: 187 VPAFRCSEGADFRSKVHRAVRHLQFQTFIGLIFMLEHLINGLGKLVSCFLFTFI 240