BLASTX nr result
ID: Ophiopogon24_contig00025594
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00025594 (352 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020262741.1| uncharacterized protein LOC109838730 [Aspara... 62 8e-09 >ref|XP_020262741.1| uncharacterized protein LOC109838730 [Asparagus officinalis] ref|XP_020262742.1| uncharacterized protein LOC109838730 [Asparagus officinalis] gb|ONK73401.1| uncharacterized protein A4U43_C04F31100 [Asparagus officinalis] Length = 1098 Score = 62.4 bits (150), Expect = 8e-09 Identities = 37/82 (45%), Positives = 50/82 (60%) Frame = +2 Query: 2 ISQIMLEKVNPSGSSVHDTGEDNSAEINIDCRNKLSAHVTCTSFNNEMPNSELLAASLPW 181 ISQ +LEKV V DT E+N E + DCRN + +T +N+EM NSE + +SL W Sbjct: 206 ISQELLEKVTSPSLLVRDTEENNITENSNDCRNNPARALTLKLYNDEMHNSEQV-SSLHW 264 Query: 182 EFSGKNPSSVQSGRCDGLNQAM 247 E SG+N S SGR + L+ +M Sbjct: 265 ESSGENLSCAHSGRFEILSDSM 286