BLASTX nr result
ID: Ophiopogon24_contig00025582
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00025582 (506 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK59007.1| uncharacterized protein A4U43_C08F2010 [Asparagus... 71 9e-13 ref|XP_020243780.1| LOW QUALITY PROTEIN: peroxisome biogenesis p... 71 1e-11 ref|XP_020094535.1| peroxisome biogenesis protein 19-1-like isof... 66 6e-10 ref|XP_020094534.1| peroxisome biogenesis protein 19-1-like isof... 66 7e-10 gb|PKA46468.1| Peroxisome biogenesis protein 19-2 [Apostasia she... 63 7e-10 ref|XP_009382423.1| PREDICTED: peroxisome biogenesis protein 19-... 66 7e-10 ref|XP_015962527.1| peroxisome biogenesis protein 19-2-like [Ara... 63 1e-09 gb|PPS07986.1| hypothetical protein GOBAR_AA12662 [Gossypium bar... 65 2e-09 ref|XP_016721897.1| PREDICTED: peroxisome biogenesis protein 19-... 65 2e-09 ref|XP_021279661.1| peroxisome biogenesis protein 19-2-like [Her... 62 3e-09 ref|XP_022739152.1| peroxisome biogenesis protein 19-2-like isof... 64 3e-09 gb|KJB25611.1| hypothetical protein B456_004G198700 [Gossypium r... 64 3e-09 gb|OVA14414.1| Pex19 protein [Macleaya cordata] 64 3e-09 ref|XP_021615022.1| peroxisome biogenesis protein 19-1-like isof... 64 4e-09 ref|XP_021615016.1| peroxisome biogenesis protein 19-2-like isof... 64 4e-09 ref|XP_012069981.1| peroxisome biogenesis protein 19-2 [Jatropha... 64 4e-09 gb|KMZ58498.1| Peroxisome biogenesis protein 19-2 [Zostera marina] 64 5e-09 ref|XP_010919564.1| PREDICTED: peroxisome biogenesis protein 19-... 64 5e-09 ref|XP_017699424.1| PREDICTED: peroxisome biogenesis protein 19-... 64 5e-09 gb|PPE00206.1| hypothetical protein GOBAR_DD02782 [Gossypium bar... 64 5e-09 >gb|ONK59007.1| uncharacterized protein A4U43_C08F2010 [Asparagus officinalis] Length = 125 Score = 71.2 bits (173), Expect = 9e-13 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -1 Query: 506 QKIVDLMQKMQECGQPPSDIVQDLAPELDLANLGGQL 396 QKIVDLMQKMQECGQPPSDIVQ+LAP+LD+ANL GQL Sbjct: 75 QKIVDLMQKMQECGQPPSDIVQELAPDLDIANLEGQL 111 >ref|XP_020243780.1| LOW QUALITY PROTEIN: peroxisome biogenesis protein 19-1-like [Asparagus officinalis] Length = 257 Score = 71.2 bits (173), Expect = 1e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -1 Query: 506 QKIVDLMQKMQECGQPPSDIVQDLAPELDLANLGGQL 396 QKIVDLMQKMQECGQPPSDIVQ+LAP+LD+ANL GQL Sbjct: 207 QKIVDLMQKMQECGQPPSDIVQELAPDLDIANLEGQL 243 >ref|XP_020094535.1| peroxisome biogenesis protein 19-1-like isoform X2 [Ananas comosus] Length = 249 Score = 66.2 bits (160), Expect = 6e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 503 KIVDLMQKMQECGQPPSDIVQDLAPELDLANLG 405 KIVDLMQKMQECGQPP+DIVQ+LAPELDL+NLG Sbjct: 201 KIVDLMQKMQECGQPPNDIVQELAPELDLSNLG 233 >ref|XP_020094534.1| peroxisome biogenesis protein 19-1-like isoform X1 [Ananas comosus] Length = 258 Score = 66.2 bits (160), Expect = 7e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 503 KIVDLMQKMQECGQPPSDIVQDLAPELDLANLG 405 KIVDLMQKMQECGQPP+DIVQ+LAPELDL+NLG Sbjct: 210 KIVDLMQKMQECGQPPNDIVQELAPELDLSNLG 242 >gb|PKA46468.1| Peroxisome biogenesis protein 19-2 [Apostasia shenzhenica] Length = 105 Score = 63.2 bits (152), Expect = 7e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 506 QKIVDLMQKMQECGQPPSDIVQDLAPELDLANL 408 QKIVDLMQKMQECGQPPSDIVQ+LAP LDL NL Sbjct: 70 QKIVDLMQKMQECGQPPSDIVQELAPGLDLNNL 102 >ref|XP_009382423.1| PREDICTED: peroxisome biogenesis protein 19-2 [Musa acuminata subsp. malaccensis] Length = 262 Score = 66.2 bits (160), Expect = 7e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 503 KIVDLMQKMQECGQPPSDIVQDLAPELDLANLG 405 KIVDLMQKMQECGQPPSDIVQ+LAP+LDL+NLG Sbjct: 214 KIVDLMQKMQECGQPPSDIVQELAPDLDLSNLG 246 >ref|XP_015962527.1| peroxisome biogenesis protein 19-2-like [Arachis duranensis] Length = 105 Score = 62.8 bits (151), Expect = 1e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 503 KIVDLMQKMQECGQPPSDIVQDLAPELDLANLG 405 KIVDLM KMQECGQPP+DIVQ+LAP+ DLANLG Sbjct: 71 KIVDLMHKMQECGQPPNDIVQELAPDFDLANLG 103 >gb|PPS07986.1| hypothetical protein GOBAR_AA12662 [Gossypium barbadense] Length = 245 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 503 KIVDLMQKMQECGQPPSDIVQDLAPELDLANLG 405 KIVDLMQKMQECGQPP+DIVQ+LAPE DL+NLG Sbjct: 197 KIVDLMQKMQECGQPPNDIVQELAPEFDLSNLG 229 >ref|XP_016721897.1| PREDICTED: peroxisome biogenesis protein 19-2-like [Gossypium hirsutum] ref|XP_017624059.1| PREDICTED: peroxisome biogenesis protein 19-2-like [Gossypium arboreum] gb|KHG09950.1| Peroxisome biogenesis 19-2 -like protein [Gossypium arboreum] Length = 245 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 503 KIVDLMQKMQECGQPPSDIVQDLAPELDLANLG 405 KIVDLMQKMQECGQPP+DIVQ+LAPE DL+NLG Sbjct: 197 KIVDLMQKMQECGQPPNDIVQELAPEFDLSNLG 229 >ref|XP_021279661.1| peroxisome biogenesis protein 19-2-like [Herrania umbratica] Length = 119 Score = 62.0 bits (149), Expect = 3e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 503 KIVDLMQKMQECGQPPSDIVQDLAPELDLANLG 405 +IVDLMQKMQECGQPP+DIVQ+LAPE D +NLG Sbjct: 71 RIVDLMQKMQECGQPPNDIVQELAPEFDFSNLG 103 >ref|XP_022739152.1| peroxisome biogenesis protein 19-2-like isoform X3 [Durio zibethinus] Length = 191 Score = 63.5 bits (153), Expect = 3e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 503 KIVDLMQKMQECGQPPSDIVQDLAPELDLANLG 405 +IVDLMQKMQECGQPP+DIVQ+LAPE DL+NLG Sbjct: 143 RIVDLMQKMQECGQPPNDIVQELAPEFDLSNLG 175 >gb|KJB25611.1| hypothetical protein B456_004G198700 [Gossypium raimondii] Length = 191 Score = 63.5 bits (153), Expect = 3e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 503 KIVDLMQKMQECGQPPSDIVQDLAPELDLANLG 405 +IVDLMQKMQECGQPP+DIVQ+LAPE DL+NLG Sbjct: 143 RIVDLMQKMQECGQPPNDIVQELAPEFDLSNLG 175 >gb|OVA14414.1| Pex19 protein [Macleaya cordata] Length = 244 Score = 64.3 bits (155), Expect = 3e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 503 KIVDLMQKMQECGQPPSDIVQDLAPELDLANLG 405 KIV+LMQKMQECGQPPSDIVQ+LAP+LDL NLG Sbjct: 196 KIVELMQKMQECGQPPSDIVQELAPDLDLTNLG 228 >ref|XP_021615022.1| peroxisome biogenesis protein 19-1-like isoform X2 [Manihot esculenta] gb|OAY60028.1| hypothetical protein MANES_01G080600 [Manihot esculenta] Length = 248 Score = 63.9 bits (154), Expect = 4e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 503 KIVDLMQKMQECGQPPSDIVQDLAPELDLANLG 405 KIVDLMQKMQECGQPP+DIVQ+LAP++D ANLG Sbjct: 200 KIVDLMQKMQECGQPPNDIVQELAPDIDFANLG 232 >ref|XP_021615016.1| peroxisome biogenesis protein 19-2-like isoform X1 [Manihot esculenta] gb|OAY60029.1| hypothetical protein MANES_01G080600 [Manihot esculenta] Length = 249 Score = 63.9 bits (154), Expect = 4e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 503 KIVDLMQKMQECGQPPSDIVQDLAPELDLANLG 405 KIVDLMQKMQECGQPP+DIVQ+LAP++D ANLG Sbjct: 201 KIVDLMQKMQECGQPPNDIVQELAPDIDFANLG 233 >ref|XP_012069981.1| peroxisome biogenesis protein 19-2 [Jatropha curcas] gb|KDP39871.1| hypothetical protein JCGZ_03402 [Jatropha curcas] Length = 250 Score = 63.9 bits (154), Expect = 4e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 503 KIVDLMQKMQECGQPPSDIVQDLAPELDLANLG 405 KIVDLMQKMQECGQPP+DIVQ+LAP++D ANLG Sbjct: 202 KIVDLMQKMQECGQPPNDIVQELAPDIDFANLG 234 >gb|KMZ58498.1| Peroxisome biogenesis protein 19-2 [Zostera marina] Length = 255 Score = 63.9 bits (154), Expect = 5e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 503 KIVDLMQKMQECGQPPSDIVQDLAPELDLANLG 405 KI++LMQKMQECGQPP+DI+ DLAPELDLANLG Sbjct: 204 KILELMQKMQECGQPPNDIIHDLAPELDLANLG 236 >ref|XP_010919564.1| PREDICTED: peroxisome biogenesis protein 19-2-like [Elaeis guineensis] Length = 257 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 503 KIVDLMQKMQECGQPPSDIVQDLAPELDLANLG 405 KIVDLMQKMQECGQPP+DIVQ+LAP+LDL NLG Sbjct: 209 KIVDLMQKMQECGQPPNDIVQELAPDLDLNNLG 241 >ref|XP_017699424.1| PREDICTED: peroxisome biogenesis protein 19-2-like [Phoenix dactylifera] Length = 257 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 503 KIVDLMQKMQECGQPPSDIVQDLAPELDLANLG 405 KIVDLMQKMQECGQPP+DIVQ+LAP+LDL NLG Sbjct: 209 KIVDLMQKMQECGQPPNDIVQELAPDLDLNNLG 241 >gb|PPE00206.1| hypothetical protein GOBAR_DD02782 [Gossypium barbadense] Length = 231 Score = 63.5 bits (153), Expect = 5e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 503 KIVDLMQKMQECGQPPSDIVQDLAPELDLANLG 405 +IVDLMQKMQECGQPP+DIVQ+LAPE DL+NLG Sbjct: 197 RIVDLMQKMQECGQPPNDIVQELAPEFDLSNLG 229