BLASTX nr result
ID: Ophiopogon24_contig00025414
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00025414 (397 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK77197.1| uncharacterized protein A4U43_C02F4090 [Asparagus... 75 6e-13 >gb|ONK77197.1| uncharacterized protein A4U43_C02F4090 [Asparagus officinalis] Length = 1860 Score = 74.7 bits (182), Expect = 6e-13 Identities = 52/131 (39%), Positives = 71/131 (54%) Frame = -1 Query: 394 EHLPLYSANPMLSADVQVQNGESGFMVNFDAEMPKQSHHAASMEHFPLDSANEIFPDGMQ 215 E LPLY A+ M S ++Q+QN G +N D E P ++HHAA MEH PL ANEI + + Sbjct: 1009 ECLPLYFADEMFSVNMQLQNEGPG--LNSDGEEPTEAHHAALMEHLPLGYANEILINDVL 1066 Query: 214 LLNKECGLMMTSDEDPKESSSADSAEHFILDSTNEMFPDKMELQNKELGCMTDGFEAVSD 35 + +++ G +D K+ S ADS EHF L S PD G M +G E +D Sbjct: 1067 VPSEKRGPETYDSKDLKQ-SPADSEEHFPLASVQNGDPD---------GRMKEGAEPAAD 1116 Query: 34 TLGLPSGSIAS 2 L L + S A+ Sbjct: 1117 FLRLANESTAT 1127