BLASTX nr result
ID: Ophiopogon24_contig00025318
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00025318 (456 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020260062.1| pentatricopeptide repeat-containing protein ... 60 1e-07 >ref|XP_020260062.1| pentatricopeptide repeat-containing protein At3g14730-like [Asparagus officinalis] ref|XP_020260063.1| pentatricopeptide repeat-containing protein At3g14730-like [Asparagus officinalis] gb|ONK71012.1| uncharacterized protein A4U43_C04F3810 [Asparagus officinalis] Length = 627 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/56 (55%), Positives = 39/56 (69%) Frame = +1 Query: 184 PNEMNKKLSTLISHLHHCSHTQNLPKTQQLHSHLITTGLLLSSPQATTSLISIYSA 351 P ++ L+ LISHL CS TQNL + +Q+HSHLIT S PQ TTSLIS+YS+ Sbjct: 5 PPKLTVNLARLISHLQLCSKTQNLSRAKQIHSHLITNN-FHSCPQTTTSLISLYSS 59