BLASTX nr result
ID: Ophiopogon24_contig00024714
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00024714 (385 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PPS00806.1| hypothetical protein GOBAR_AA19862 [Gossypium bar... 80 4e-16 gb|PPD83764.1| hypothetical protein GOBAR_DD19285 [Gossypium bar... 80 6e-15 ref|XP_017609893.1| PREDICTED: magnesium transporter MRS2-1-like... 80 6e-15 ref|XP_016671955.1| PREDICTED: magnesium transporter MRS2-1-like... 80 6e-15 ref|XP_012485029.1| PREDICTED: magnesium transporter MRS2-1-like... 80 6e-15 ref|XP_011082460.1| magnesium transporter MRS2-1 [Sesamum indicu... 80 6e-15 gb|OMO85660.1| Mg2+ transporter protein, CorA-like/Zinc transpor... 78 8e-15 gb|PPS03801.1| hypothetical protein GOBAR_AA16862 [Gossypium bar... 78 1e-14 ref|XP_006493378.1| PREDICTED: magnesium transporter MRS2-1 [Cit... 79 1e-14 ref|XP_024036329.1| magnesium transporter MRS2-1 [Citrus clement... 79 1e-14 gb|PNX84187.1| magnesium transporter MRS2-1-like protein [Trifol... 77 1e-14 gb|EOY26084.1| Magnesium transporter 2 isoform 2 [Theobroma cacao] 78 2e-14 ref|XP_018847528.1| PREDICTED: magnesium transporter MRS2-1 [Jug... 78 3e-14 gb|OMO74032.1| Mg2+ transporter protein, CorA-like/Zinc transpor... 78 3e-14 gb|EOY26085.1| Magnesium transporter isoform 3 [Theobroma cacao] 78 3e-14 ref|XP_017620726.1| PREDICTED: magnesium transporter MRS2-1 [Gos... 78 4e-14 ref|XP_016683262.1| PREDICTED: magnesium transporter MRS2-1 [Gos... 78 4e-14 ref|XP_016753396.1| PREDICTED: magnesium transporter MRS2-1-like... 78 4e-14 ref|XP_012449325.1| PREDICTED: magnesium transporter MRS2-1 isof... 78 4e-14 ref|XP_007023461.1| PREDICTED: magnesium transporter MRS2-1 [The... 78 4e-14 >gb|PPS00806.1| hypothetical protein GOBAR_AA19862 [Gossypium barbadense] Length = 191 Score = 80.1 bits (196), Expect = 4e-16 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNF IPFFD+ GAF+WVLI+TG CG ++F AFVWFFK++RLMPL Sbjct: 148 MNFAIPFFDDPGAFKWVLIITGVCGIIIFCAFVWFFKYRRLMPL 191 >gb|PPD83764.1| hypothetical protein GOBAR_DD19285 [Gossypium barbadense] Length = 437 Score = 80.1 bits (196), Expect = 6e-15 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNF IPFFD+ GAF+WVLI+TG CG ++F AFVWFFK++RLMPL Sbjct: 394 MNFSIPFFDDPGAFKWVLIITGVCGIIIFCAFVWFFKYRRLMPL 437 >ref|XP_017609893.1| PREDICTED: magnesium transporter MRS2-1-like [Gossypium arboreum] Length = 437 Score = 80.1 bits (196), Expect = 6e-15 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNF IPFFD+ GAF+WVLI+TG CG ++F AFVWFFK++RLMPL Sbjct: 394 MNFAIPFFDDPGAFKWVLIITGVCGIIIFCAFVWFFKYRRLMPL 437 >ref|XP_016671955.1| PREDICTED: magnesium transporter MRS2-1-like [Gossypium hirsutum] Length = 437 Score = 80.1 bits (196), Expect = 6e-15 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNF IPFFD+ GAF+WVLI+TG CG ++F AFVWFFK++RLMPL Sbjct: 394 MNFAIPFFDDPGAFKWVLIITGVCGIIIFCAFVWFFKYRRLMPL 437 >ref|XP_012485029.1| PREDICTED: magnesium transporter MRS2-1-like [Gossypium raimondii] ref|XP_012485030.1| PREDICTED: magnesium transporter MRS2-1-like [Gossypium raimondii] ref|XP_012485031.1| PREDICTED: magnesium transporter MRS2-1-like [Gossypium raimondii] gb|KJB35251.1| hypothetical protein B456_006G106900 [Gossypium raimondii] gb|KJB35252.1| hypothetical protein B456_006G106900 [Gossypium raimondii] gb|KJB35253.1| hypothetical protein B456_006G106900 [Gossypium raimondii] gb|KJB35254.1| hypothetical protein B456_006G106900 [Gossypium raimondii] gb|KJB35255.1| hypothetical protein B456_006G106900 [Gossypium raimondii] Length = 437 Score = 80.1 bits (196), Expect = 6e-15 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNF IPFFD+ GAF+WVLI+TG CG ++F AFVWFFK++RLMPL Sbjct: 394 MNFAIPFFDDPGAFKWVLIITGVCGIIIFCAFVWFFKYRRLMPL 437 >ref|XP_011082460.1| magnesium transporter MRS2-1 [Sesamum indicum] ref|XP_011082470.1| magnesium transporter MRS2-1 [Sesamum indicum] Length = 445 Score = 80.1 bits (196), Expect = 6e-15 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNFPI FD+ GAF+WVLI+TG CGAV+FS+F+WFFK++RLMPL Sbjct: 402 MNFPIAMFDDPGAFQWVLIITGVCGAVIFSSFLWFFKYRRLMPL 445 >gb|OMO85660.1| Mg2+ transporter protein, CorA-like/Zinc transport protein ZntB, partial [Corchorus capsularis] Length = 262 Score = 78.2 bits (191), Expect = 8e-15 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNF IP FD+AGAF+WVLI+TG G V+FSAFVWFFK++RLMPL Sbjct: 219 MNFEIPMFDDAGAFKWVLIITGISGVVIFSAFVWFFKYRRLMPL 262 >gb|PPS03801.1| hypothetical protein GOBAR_AA16862 [Gossypium barbadense] Length = 268 Score = 77.8 bits (190), Expect = 1e-14 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNF IP FD+ GAF+WVLI+TG CG ++F AFVWFFK++RLMPL Sbjct: 225 MNFAIPMFDDPGAFKWVLIITGVCGIIIFCAFVWFFKYRRLMPL 268 >ref|XP_006493378.1| PREDICTED: magnesium transporter MRS2-1 [Citrus sinensis] ref|XP_006493380.1| PREDICTED: magnesium transporter MRS2-1 [Citrus sinensis] ref|XP_015381100.1| PREDICTED: magnesium transporter MRS2-1 [Citrus sinensis] Length = 441 Score = 79.0 bits (193), Expect = 1e-14 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNF IPFFDE AF+WVLI+TG CG ++F AFVWFFK++RLMPL Sbjct: 398 MNFTIPFFDEPAAFKWVLIITGVCGIIIFCAFVWFFKYRRLMPL 441 >ref|XP_024036329.1| magnesium transporter MRS2-1 [Citrus clementina] ref|XP_024036330.1| magnesium transporter MRS2-1 [Citrus clementina] gb|ESR40892.1| hypothetical protein CICLE_v10025612mg [Citrus clementina] gb|KDO55341.1| hypothetical protein CISIN_1g013533mg [Citrus sinensis] gb|KDO55342.1| hypothetical protein CISIN_1g013533mg [Citrus sinensis] gb|KDO55343.1| hypothetical protein CISIN_1g013533mg [Citrus sinensis] dbj|GAY55450.1| hypothetical protein CUMW_164310 [Citrus unshiu] dbj|GAY55451.1| hypothetical protein CUMW_164310 [Citrus unshiu] Length = 441 Score = 79.0 bits (193), Expect = 1e-14 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNF IPFFDE AF+WVLI+TG CG ++F AFVWFFK++RLMPL Sbjct: 398 MNFAIPFFDEPAAFKWVLIITGVCGIIIFCAFVWFFKYRRLMPL 441 >gb|PNX84187.1| magnesium transporter MRS2-1-like protein [Trifolium pratense] Length = 259 Score = 77.4 bits (189), Expect = 1e-14 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNF IPFFD AF+WVLI+TG CG +FSAFVWFFK++RLMPL Sbjct: 216 MNFEIPFFDVPSAFQWVLIITGVCGVCIFSAFVWFFKYRRLMPL 259 >gb|EOY26084.1| Magnesium transporter 2 isoform 2 [Theobroma cacao] Length = 331 Score = 77.8 bits (190), Expect = 2e-14 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNF IP FD+ GAF+WVLIVTG CG ++F AFVWFFK++RLMPL Sbjct: 288 MNFAIPLFDDPGAFKWVLIVTGICGIIIFCAFVWFFKYRRLMPL 331 >ref|XP_018847528.1| PREDICTED: magnesium transporter MRS2-1 [Juglans regia] ref|XP_018847529.1| PREDICTED: magnesium transporter MRS2-1 [Juglans regia] ref|XP_018847530.1| PREDICTED: magnesium transporter MRS2-1 [Juglans regia] ref|XP_018847531.1| PREDICTED: magnesium transporter MRS2-1 [Juglans regia] ref|XP_018847532.1| PREDICTED: magnesium transporter MRS2-1 [Juglans regia] ref|XP_018847533.1| PREDICTED: magnesium transporter MRS2-1 [Juglans regia] ref|XP_018847534.1| PREDICTED: magnesium transporter MRS2-1 [Juglans regia] ref|XP_018847535.1| PREDICTED: magnesium transporter MRS2-1 [Juglans regia] Length = 443 Score = 78.2 bits (191), Expect = 3e-14 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNF IP FD+ GAF+WVLI+TG G V+FS+FVWFFKH+RLMPL Sbjct: 400 MNFSIPLFDDTGAFKWVLIITGVTGVVIFSSFVWFFKHRRLMPL 443 >gb|OMO74032.1| Mg2+ transporter protein, CorA-like/Zinc transport protein ZntB [Corchorus olitorius] Length = 458 Score = 78.2 bits (191), Expect = 3e-14 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNF IP FD+AGAF+WVLI+TG G V+FSAFVWFFK++RLMPL Sbjct: 415 MNFEIPMFDDAGAFKWVLIITGISGVVIFSAFVWFFKYRRLMPL 458 >gb|EOY26085.1| Magnesium transporter isoform 3 [Theobroma cacao] Length = 405 Score = 77.8 bits (190), Expect = 3e-14 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNF IP FD+ GAF+WVLIVTG CG ++F AFVWFFK++RLMPL Sbjct: 362 MNFAIPLFDDPGAFKWVLIVTGICGIIIFCAFVWFFKYRRLMPL 405 >ref|XP_017620726.1| PREDICTED: magnesium transporter MRS2-1 [Gossypium arboreum] ref|XP_017620727.1| PREDICTED: magnesium transporter MRS2-1 [Gossypium arboreum] Length = 442 Score = 77.8 bits (190), Expect = 4e-14 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNF IP FD+ GAF+WVLI+TG CG ++F AFVWFFK++RLMPL Sbjct: 399 MNFAIPMFDDPGAFKWVLIITGVCGIIIFCAFVWFFKYRRLMPL 442 >ref|XP_016683262.1| PREDICTED: magnesium transporter MRS2-1 [Gossypium hirsutum] ref|XP_016683263.1| PREDICTED: magnesium transporter MRS2-1 [Gossypium hirsutum] Length = 442 Score = 77.8 bits (190), Expect = 4e-14 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNF IP FD+ GAF+WVLI+TG CG ++F AFVWFFK++RLMPL Sbjct: 399 MNFAIPMFDDPGAFKWVLIITGVCGIIIFCAFVWFFKYRRLMPL 442 >ref|XP_016753396.1| PREDICTED: magnesium transporter MRS2-1-like [Gossypium hirsutum] ref|XP_016753397.1| PREDICTED: magnesium transporter MRS2-1-like [Gossypium hirsutum] ref|XP_016753398.1| PREDICTED: magnesium transporter MRS2-1-like [Gossypium hirsutum] Length = 442 Score = 77.8 bits (190), Expect = 4e-14 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNF IP FD+ GAF+WVLI+TG CG ++F AFVWFFK++RLMPL Sbjct: 399 MNFAIPMFDDPGAFKWVLIITGVCGIIIFCAFVWFFKYRRLMPL 442 >ref|XP_012449325.1| PREDICTED: magnesium transporter MRS2-1 isoform X1 [Gossypium raimondii] ref|XP_012449326.1| PREDICTED: magnesium transporter MRS2-1 isoform X1 [Gossypium raimondii] gb|KJB66344.1| hypothetical protein B456_010G136800 [Gossypium raimondii] Length = 442 Score = 77.8 bits (190), Expect = 4e-14 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNF IP FD+ GAF+WVLI+TG CG ++F AFVWFFK++RLMPL Sbjct: 399 MNFAIPMFDDPGAFKWVLIITGVCGIIIFCAFVWFFKYRRLMPL 442 >ref|XP_007023461.1| PREDICTED: magnesium transporter MRS2-1 [Theobroma cacao] ref|XP_017978913.1| PREDICTED: magnesium transporter MRS2-1 [Theobroma cacao] gb|EOY26083.1| Magnesium transporter isoform 1 [Theobroma cacao] Length = 442 Score = 77.8 bits (190), Expect = 4e-14 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -3 Query: 326 MNFPIPFFDEAGAFEWVLIVTGACGAVVFSAFVWFFKHKRLMPL 195 MNF IP FD+ GAF+WVLIVTG CG ++F AFVWFFK++RLMPL Sbjct: 399 MNFAIPLFDDPGAFKWVLIVTGICGIIIFCAFVWFFKYRRLMPL 442