BLASTX nr result
ID: Ophiopogon24_contig00024504
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00024504 (1377 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020248990.1| transcription initiation factor TFIID subuni... 70 5e-09 gb|ONK56593.1| uncharacterized protein A4U43_C10F10470 [Asparagu... 70 5e-09 >ref|XP_020248990.1| transcription initiation factor TFIID subunit 2 [Asparagus officinalis] Length = 1315 Score = 70.5 bits (171), Expect = 5e-09 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = +2 Query: 2 DESRWSSLSCCQTAADAACKTYLLLLNNVMDPNLLISCRVSK 127 DE RWSS+SCCQTAADAAC TYL LLN M PNLLISC SK Sbjct: 85 DERRWSSVSCCQTAADAACSTYLSLLNREMVPNLLISCNKSK 126 >gb|ONK56593.1| uncharacterized protein A4U43_C10F10470 [Asparagus officinalis] Length = 1442 Score = 70.5 bits (171), Expect = 5e-09 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = +2 Query: 2 DESRWSSLSCCQTAADAACKTYLLLLNNVMDPNLLISCRVSK 127 DE RWSS+SCCQTAADAAC TYL LLN M PNLLISC SK Sbjct: 85 DERRWSSVSCCQTAADAACSTYLSLLNREMVPNLLISCNKSK 126