BLASTX nr result
ID: Ophiopogon24_contig00024190
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00024190 (434 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275600.1| CTL-like protein DDB_G0274487 [Asparagus off... 56 2e-06 >ref|XP_020275600.1| CTL-like protein DDB_G0274487 [Asparagus officinalis] gb|ONK63786.1| uncharacterized protein A4U43_C07F18910 [Asparagus officinalis] Length = 506 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 3 QRLQYRSVRARQVMLNSRFDQMSSEIMQTPSI 98 QRLQYRS RAR VM+NSRFDQMSSEI+QTP I Sbjct: 475 QRLQYRSARARHVMVNSRFDQMSSEIIQTPPI 506