BLASTX nr result
ID: Ophiopogon24_contig00024112
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00024112 (439 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63172.1| hypothetical protein 20.t00024 [Asparagus officin... 62 5e-09 gb|ABB55317.1| zinc transporter, putative [Asparagus officinalis] 60 8e-08 >gb|ABD63172.1| hypothetical protein 20.t00024 [Asparagus officinalis] Length = 204 Score = 62.4 bits (150), Expect = 5e-09 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 2/82 (2%) Frame = -2 Query: 399 KSDRRTIFRKPVFFFGD--SNEVEELYDRNYKWLHHIEDQCFFLSSMEWMIPLSYLQSMS 226 +S R KP + FGD + YD +YKWL + D+ FL +ME M P+SY Q S Sbjct: 53 ESPSRKPIVKPGYLFGDFVDFDASTAYDGDYKWLRKVGDRNLFLPNMERMFPISYFQCAS 112 Query: 225 IPQQMD*DLTKAKLRVAIGTIS 160 +P+ MD L K + VA+GT++ Sbjct: 113 VPRHMDWPLVKNQDGVALGTLT 134 >gb|ABB55317.1| zinc transporter, putative [Asparagus officinalis] Length = 617 Score = 60.5 bits (145), Expect = 8e-08 Identities = 38/105 (36%), Positives = 60/105 (57%), Gaps = 2/105 (1%) Frame = -2 Query: 378 FRKPVFFFGDSNEVEE--LYDRNYKWLHHIEDQCFFLSSMEWMIPLSYLQSMSIPQQMD* 205 + KP F FGDS +++ + + NYKWL + ++ FL ++E M PLSY Q SIPQ M+ Sbjct: 502 YPKPSFLFGDSVKMDSKRVSEGNYKWLRTVNNRRLFLPNLERMWPLSYYQCASIPQSMNW 561 Query: 204 DLTKAKLRVAIGTISNRDVFPACHGRDITGLLLGLVRQDYP*GTL 70 +L + + VA G I++R A + L GL ++++ G L Sbjct: 562 ELVQDQGGVATGHITHRGTHSAGF-NNFMALKPGLFQKEHHVGEL 605