BLASTX nr result
ID: Ophiopogon24_contig00023912
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00023912 (378 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275344.1| ribosome-recycling factor, chloroplastic [As... 77 2e-14 >ref|XP_020275344.1| ribosome-recycling factor, chloroplastic [Asparagus officinalis] gb|ONK62291.1| uncharacterized protein A4U43_C07F2390 [Asparagus officinalis] Length = 277 Score = 77.4 bits (189), Expect = 2e-14 Identities = 37/53 (69%), Positives = 43/53 (81%) Frame = +1 Query: 178 SDPYQRRENHTGHVCVNANLLSSTANYVRLLEGAGAFAIRSLSTNHIVKKRTG 336 +DPYQRRENHT H+CV+A +LSSTAN VRL EG GAF+ RS + IVKKRTG Sbjct: 28 TDPYQRRENHTRHLCVHAKVLSSTANCVRLQEGTGAFSSRSPTAKQIVKKRTG 80