BLASTX nr result
ID: Ophiopogon24_contig00023851
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00023851 (852 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020271616.1| WRKY transcription factor 55-like [Asparagus... 59 2e-06 >ref|XP_020271616.1| WRKY transcription factor 55-like [Asparagus officinalis] gb|ONK62707.1| uncharacterized protein A4U43_C07F7180 [Asparagus officinalis] Length = 313 Score = 59.3 bits (142), Expect = 2e-06 Identities = 34/61 (55%), Positives = 39/61 (63%), Gaps = 2/61 (3%) Frame = -3 Query: 769 RGSRKRGRKECGRLGFR--QAQTGNMENLPDDGYRWMKYRQKDILSSKFPRSWPSTAVFK 596 R SRKR R+ G R +TGNMEN PDDGY W KY QKDIL S+FPRS+ F+ Sbjct: 119 RQSRKR-RENRGMTTVRVPAVRTGNMENPPDDGYTWRKYGQKDILGSRFPRSY-----FR 172 Query: 595 C 593 C Sbjct: 173 C 173