BLASTX nr result
ID: Ophiopogon24_contig00023761
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00023761 (844 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009412794.1| PREDICTED: glyceraldehyde-3-phosphate dehydr... 59 2e-07 gb|EOX90938.1| Uncharacterized protein TCM_000269 [Theobroma cacao] 59 2e-07 ref|XP_022775377.1| uncharacterized protein LOC111317219 [Durio ... 59 2e-07 gb|KZV41243.1| hypothetical protein F511_28658 [Dorcoceras hygro... 57 3e-07 gb|EEF28728.1| conserved hypothetical protein [Ricinus communis] 57 3e-07 ref|XP_022132632.1| uncharacterized protein LOC111005446 [Momord... 59 4e-07 gb|ERM96353.1| hypothetical protein AMTR_s00001p00221310 [Ambore... 58 4e-07 ref|XP_018828818.1| PREDICTED: uncharacterized protein LOC108997... 59 4e-07 ref|XP_002267482.1| PREDICTED: uncharacterized protein LOC100260... 59 4e-07 gb|KMT09501.1| hypothetical protein BVRB_6g129690 [Beta vulgaris... 57 4e-07 dbj|GAY42608.1| hypothetical protein CUMW_068240 [Citrus unshiu] 59 4e-07 gb|KDO71076.1| hypothetical protein CISIN_1g043482mg [Citrus sin... 59 4e-07 ref|XP_006466886.1| PREDICTED: uncharacterized protein LOC102627... 59 4e-07 ref|XP_006425565.1| uncharacterized protein LOC18036172 [Citrus ... 59 4e-07 ref|XP_021717849.1| uncharacterized protein LOC110685610 [Chenop... 59 4e-07 gb|OMO56995.1| hypothetical protein CCACVL1_26091 [Corchorus cap... 59 4e-07 ref|XP_016724802.1| PREDICTED: uncharacterized protein LOC107936... 59 5e-07 ref|XP_012469375.1| PREDICTED: uncharacterized protein LOC105787... 59 5e-07 ref|XP_017645021.1| PREDICTED: uncharacterized protein LOC108485... 59 5e-07 ref|XP_016461458.1| PREDICTED: uncharacterized protein LOC107784... 59 5e-07 >ref|XP_009412794.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, testis-specific [Musa acuminata subsp. malaccensis] Length = 121 Score = 59.3 bits (142), Expect = 2e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 472 GDCCGSGCVRCVWDIYYEELEAY 404 GDCCGSGCVRCVWDIYYEELEAY Sbjct: 86 GDCCGSGCVRCVWDIYYEELEAY 108 >gb|EOX90938.1| Uncharacterized protein TCM_000269 [Theobroma cacao] Length = 118 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 472 GDCCGSGCVRCVWDIYYEELEAY 404 GDCCGSGCVRCVWD+YYEELEAY Sbjct: 83 GDCCGSGCVRCVWDVYYEELEAY 105 >ref|XP_022775377.1| uncharacterized protein LOC111317219 [Durio zibethinus] Length = 119 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 472 GDCCGSGCVRCVWDIYYEELEAY 404 GDCCGSGCVRCVWD+YYEELEAY Sbjct: 80 GDCCGSGCVRCVWDVYYEELEAY 102 >gb|KZV41243.1| hypothetical protein F511_28658 [Dorcoceras hygrometricum] Length = 68 Score = 57.0 bits (136), Expect = 3e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 472 GDCCGSGCVRCVWDIYYEELEAY 404 GDCCGSGCVRCVWD+YYEELE Y Sbjct: 34 GDCCGSGCVRCVWDVYYEELEEY 56 >gb|EEF28728.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 57.0 bits (136), Expect = 3e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 472 GDCCGSGCVRCVWDIYYEELEAY 404 GDCCGSGCVRCVWD+YYEELE Y Sbjct: 37 GDCCGSGCVRCVWDVYYEELEEY 59 >ref|XP_022132632.1| uncharacterized protein LOC111005446 [Momordica charantia] Length = 142 Score = 58.9 bits (141), Expect = 4e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 472 GDCCGSGCVRCVWDIYYEELEAY 404 GDCCGSGCVRCVWD+YYEELEAY Sbjct: 106 GDCCGSGCVRCVWDVYYEELEAY 128 >gb|ERM96353.1| hypothetical protein AMTR_s00001p00221310 [Amborella trichopoda] Length = 100 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/57 (49%), Positives = 31/57 (54%) Frame = -1 Query: 574 QKEEEMKKEDXXXXXXXXXXXXXXXXXXXXXXXPGDCCGSGCVRCVWDIYYEELEAY 404 QKEEE KKE+ GDCCGSGC RC+WDIYYE+LEAY Sbjct: 45 QKEEESKKEEEVMVVPPPPPPPEKPLP-------GDCCGSGCERCIWDIYYEDLEAY 94 >ref|XP_018828818.1| PREDICTED: uncharacterized protein LOC108997129 [Juglans regia] Length = 160 Score = 59.3 bits (142), Expect = 4e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 472 GDCCGSGCVRCVWDIYYEELEAY 404 GDCCGSGCVRCVWDIYYEELEAY Sbjct: 123 GDCCGSGCVRCVWDIYYEELEAY 145 >ref|XP_002267482.1| PREDICTED: uncharacterized protein LOC100260912 [Vitis vinifera] Length = 144 Score = 58.9 bits (141), Expect = 4e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 472 GDCCGSGCVRCVWDIYYEELEAY 404 GDCCGSGCVRCVWD+YYEELEAY Sbjct: 110 GDCCGSGCVRCVWDVYYEELEAY 132 >gb|KMT09501.1| hypothetical protein BVRB_6g129690 [Beta vulgaris subsp. vulgaris] Length = 76 Score = 57.0 bits (136), Expect = 4e-07 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = -1 Query: 472 GDCCGSGCVRCVWDIYYEELEAY 404 GDCCGSGCVRCVWDIYY+EL+AY Sbjct: 40 GDCCGSGCVRCVWDIYYDELDAY 62 >dbj|GAY42608.1| hypothetical protein CUMW_068240 [Citrus unshiu] Length = 146 Score = 58.9 bits (141), Expect = 4e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 472 GDCCGSGCVRCVWDIYYEELEAY 404 GDCCGSGCVRCVWD+YYEELEAY Sbjct: 108 GDCCGSGCVRCVWDVYYEELEAY 130 >gb|KDO71076.1| hypothetical protein CISIN_1g043482mg [Citrus sinensis] Length = 146 Score = 58.9 bits (141), Expect = 4e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 472 GDCCGSGCVRCVWDIYYEELEAY 404 GDCCGSGCVRCVWD+YYEELEAY Sbjct: 108 GDCCGSGCVRCVWDVYYEELEAY 130 >ref|XP_006466886.1| PREDICTED: uncharacterized protein LOC102627206 [Citrus sinensis] Length = 146 Score = 58.9 bits (141), Expect = 4e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 472 GDCCGSGCVRCVWDIYYEELEAY 404 GDCCGSGCVRCVWD+YYEELEAY Sbjct: 108 GDCCGSGCVRCVWDVYYEELEAY 130 >ref|XP_006425565.1| uncharacterized protein LOC18036172 [Citrus clementina] gb|ESR38805.1| hypothetical protein CICLE_v10026716mg [Citrus clementina] Length = 146 Score = 58.9 bits (141), Expect = 4e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 472 GDCCGSGCVRCVWDIYYEELEAY 404 GDCCGSGCVRCVWD+YYEELEAY Sbjct: 108 GDCCGSGCVRCVWDVYYEELEAY 130 >ref|XP_021717849.1| uncharacterized protein LOC110685610 [Chenopodium quinoa] Length = 148 Score = 58.9 bits (141), Expect = 4e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 472 GDCCGSGCVRCVWDIYYEELEAY 404 GDCCGSGCVRCVWD+YYEELEAY Sbjct: 114 GDCCGSGCVRCVWDVYYEELEAY 136 >gb|OMO56995.1| hypothetical protein CCACVL1_26091 [Corchorus capsularis] Length = 152 Score = 58.9 bits (141), Expect = 4e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 472 GDCCGSGCVRCVWDIYYEELEAY 404 GDCCGSGCVRCVWD+YYEELEAY Sbjct: 114 GDCCGSGCVRCVWDVYYEELEAY 136 >ref|XP_016724802.1| PREDICTED: uncharacterized protein LOC107936561 [Gossypium hirsutum] Length = 155 Score = 58.9 bits (141), Expect = 5e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 472 GDCCGSGCVRCVWDIYYEELEAY 404 GDCCGSGCVRCVWD+YYEELEAY Sbjct: 117 GDCCGSGCVRCVWDVYYEELEAY 139 >ref|XP_012469375.1| PREDICTED: uncharacterized protein LOC105787500 [Gossypium raimondii] gb|KJB17712.1| hypothetical protein B456_003G011700 [Gossypium raimondii] Length = 155 Score = 58.9 bits (141), Expect = 5e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 472 GDCCGSGCVRCVWDIYYEELEAY 404 GDCCGSGCVRCVWD+YYEELEAY Sbjct: 117 GDCCGSGCVRCVWDVYYEELEAY 139 >ref|XP_017645021.1| PREDICTED: uncharacterized protein LOC108485673 [Gossypium arboreum] Length = 156 Score = 58.9 bits (141), Expect = 5e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 472 GDCCGSGCVRCVWDIYYEELEAY 404 GDCCGSGCVRCVWD+YYEELEAY Sbjct: 118 GDCCGSGCVRCVWDVYYEELEAY 140 >ref|XP_016461458.1| PREDICTED: uncharacterized protein LOC107784789 [Nicotiana tabacum] Length = 157 Score = 58.9 bits (141), Expect = 5e-07 Identities = 33/85 (38%), Positives = 42/85 (49%) Frame = -1 Query: 658 PAANNLNKKSNSMESTVKDQQSRQGGLIQKEEEMKKEDXXXXXXXXXXXXXXXXXXXXXX 479 P A NKK NS+ESTV ++ + + + K E K ++ Sbjct: 71 PMAEEANKK-NSIESTVNNKCTIESTMNNKTESEKNQEKSKVTIPPPPEKPLP------- 122 Query: 478 XPGDCCGSGCVRCVWDIYYEELEAY 404 GDCCG+GCV CVWD YYEELE Y Sbjct: 123 --GDCCGNGCVPCVWDTYYEELEEY 145