BLASTX nr result
ID: Ophiopogon24_contig00023665
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00023665 (528 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015868325.1| PREDICTED: extra-large guanine nucleotide-bi... 72 5e-16 ref|XP_015897315.1| PREDICTED: extra-large guanine nucleotide-bi... 72 5e-16 ref|XP_018843921.1| PREDICTED: extra-large guanine nucleotide-bi... 70 1e-15 gb|EPS66040.1| hypothetical protein M569_08734 [Genlisea aurea] 70 1e-15 ref|XP_021808590.1| extra-large guanine nucleotide-binding prote... 70 2e-15 ref|XP_008238143.1| PREDICTED: extra-large guanine nucleotide-bi... 70 2e-15 ref|XP_007210372.1| extra-large guanine nucleotide-binding prote... 70 2e-15 ref|XP_020112794.1| extra-large guanine nucleotide-binding prote... 70 3e-15 ref|XP_020112795.1| extra-large guanine nucleotide-binding prote... 70 3e-15 ref|XP_020240768.1| extra-large guanine nucleotide-binding prote... 69 3e-15 ref|XP_020240770.1| extra-large guanine nucleotide-binding prote... 69 3e-15 ref|XP_020240771.1| extra-large guanine nucleotide-binding prote... 69 3e-15 gb|OAP18477.1| XLG3 [Arabidopsis thaliana] 69 3e-15 ref|XP_010540731.1| PREDICTED: extra-large guanine nucleotide-bi... 69 3e-15 ref|NP_174475.1| extra-large GTP-binding protein 3 [Arabidopsis ... 69 3e-15 ref|XP_020868438.1| extra-large guanine nucleotide-binding prote... 69 3e-15 ref|XP_022738946.1| extra-large guanine nucleotide-binding prote... 69 4e-15 gb|KJB51568.1| hypothetical protein B456_008G223200 [Gossypium r... 69 4e-15 ref|XP_016736562.1| PREDICTED: extra-large guanine nucleotide-bi... 69 4e-15 ref|XP_012439273.1| PREDICTED: extra-large guanine nucleotide-bi... 69 4e-15 >ref|XP_015868325.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Ziziphus jujuba] Length = 865 Score = 71.6 bits (174), Expect(2) = 5e-16 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPDI++SSNLN TGKLSP ASNGNT YI+GREITK++L Sbjct: 324 GKEGEKPDIVISSNLNFTGKLSPRASNGNTEVYINGREITKLEL 367 Score = 40.0 bits (92), Expect(2) = 5e-16 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 307 RKLKPGRYWYDKESGLWGKE 326 >ref|XP_015897315.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Ziziphus jujuba] Length = 865 Score = 71.6 bits (174), Expect(2) = 5e-16 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPDI++SSNLN TGKLSP ASNGNT YI+GREITK++L Sbjct: 324 GKEGEKPDIVISSNLNFTGKLSPRASNGNTEVYINGREITKLEL 367 Score = 40.0 bits (92), Expect(2) = 5e-16 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 307 RKLKPGRYWYDKESGLWGKE 326 >ref|XP_018843921.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Juglans regia] ref|XP_018843922.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Juglans regia] ref|XP_018843923.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Juglans regia] Length = 860 Score = 70.1 bits (170), Expect(2) = 1e-15 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPDII+SSNLN TGKL+P ASNGNT YI+GREIT+++L Sbjct: 321 GKEGEKPDIIISSNLNFTGKLNPDASNGNTEVYINGREITRLEL 364 Score = 40.0 bits (92), Expect(2) = 1e-15 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 304 RKLKPGRYWYDKESGLWGKE 323 >gb|EPS66040.1| hypothetical protein M569_08734 [Genlisea aurea] Length = 834 Score = 70.1 bits (170), Expect(2) = 1e-15 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPD I+SSNLN TGKLSP+ASNGNT YI+GREITK++L Sbjct: 315 GKEGEKPDRIISSNLNFTGKLSPAASNGNTEVYINGREITKLEL 358 Score = 40.0 bits (92), Expect(2) = 1e-15 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 298 RKLKPGRYWYDKESGLWGKE 317 >ref|XP_021808590.1| extra-large guanine nucleotide-binding protein 3 [Prunus avium] ref|XP_021808591.1| extra-large guanine nucleotide-binding protein 3 [Prunus avium] ref|XP_021808592.1| extra-large guanine nucleotide-binding protein 3 [Prunus avium] ref|XP_021808593.1| extra-large guanine nucleotide-binding protein 3 [Prunus avium] Length = 861 Score = 69.7 bits (169), Expect(2) = 2e-15 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPD I+SSNLN TGKLSP ASNGNT YI+GREITK++L Sbjct: 322 GKEGEKPDRIISSNLNFTGKLSPDASNGNTEVYINGREITKLEL 365 Score = 40.0 bits (92), Expect(2) = 2e-15 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 305 RKLKPGRYWYDKESGLWGKE 324 >ref|XP_008238143.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Prunus mume] ref|XP_008238144.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Prunus mume] ref|XP_008238145.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Prunus mume] ref|XP_008238146.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Prunus mume] ref|XP_008238147.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Prunus mume] Length = 861 Score = 69.7 bits (169), Expect(2) = 2e-15 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPD I+SSNLN TGKLSP ASNGNT YI+GREITK++L Sbjct: 322 GKEGEKPDRIISSNLNFTGKLSPDASNGNTEVYINGREITKLEL 365 Score = 40.0 bits (92), Expect(2) = 2e-15 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 305 RKLKPGRYWYDKESGLWGKE 324 >ref|XP_007210372.1| extra-large guanine nucleotide-binding protein 3 [Prunus persica] ref|XP_020419226.1| extra-large guanine nucleotide-binding protein 3 [Prunus persica] ref|XP_020419227.1| extra-large guanine nucleotide-binding protein 3 [Prunus persica] ref|XP_020419228.1| extra-large guanine nucleotide-binding protein 3 [Prunus persica] ref|XP_020419229.1| extra-large guanine nucleotide-binding protein 3 [Prunus persica] ref|XP_020419230.1| extra-large guanine nucleotide-binding protein 3 [Prunus persica] gb|ONI05837.1| hypothetical protein PRUPE_5G026100 [Prunus persica] gb|ONI05838.1| hypothetical protein PRUPE_5G026100 [Prunus persica] gb|ONI05839.1| hypothetical protein PRUPE_5G026100 [Prunus persica] gb|ONI05840.1| hypothetical protein PRUPE_5G026100 [Prunus persica] gb|ONI05841.1| hypothetical protein PRUPE_5G026100 [Prunus persica] gb|ONI05842.1| hypothetical protein PRUPE_5G026100 [Prunus persica] gb|ONI05843.1| hypothetical protein PRUPE_5G026100 [Prunus persica] gb|ONI05844.1| hypothetical protein PRUPE_5G026100 [Prunus persica] gb|ONI05845.1| hypothetical protein PRUPE_5G026100 [Prunus persica] gb|ONI05846.1| hypothetical protein PRUPE_5G026100 [Prunus persica] Length = 861 Score = 69.7 bits (169), Expect(2) = 2e-15 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPD I+SSNLN TGKLSP ASNGNT YI+GREITK++L Sbjct: 322 GKEGEKPDRIISSNLNFTGKLSPDASNGNTEVYINGREITKLEL 365 Score = 40.0 bits (92), Expect(2) = 2e-15 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 305 RKLKPGRYWYDKESGLWGKE 324 >ref|XP_020112794.1| extra-large guanine nucleotide-binding protein 3 isoform X1 [Ananas comosus] Length = 861 Score = 69.7 bits (169), Expect(2) = 3e-15 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPD+I+SSNLN TGKL P+ASNGNT YI+GREITK++L Sbjct: 322 GKEGEKPDMIISSNLNFTGKLHPNASNGNTQVYINGREITKLEL 365 Score = 39.7 bits (91), Expect(2) = 3e-15 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 305 QKLKPGRYWYDKESGLWGKE 324 >ref|XP_020112795.1| extra-large guanine nucleotide-binding protein 3 isoform X2 [Ananas comosus] Length = 859 Score = 69.7 bits (169), Expect(2) = 3e-15 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPD+I+SSNLN TGKL P+ASNGNT YI+GREITK++L Sbjct: 322 GKEGEKPDMIISSNLNFTGKLHPNASNGNTQVYINGREITKLEL 365 Score = 39.7 bits (91), Expect(2) = 3e-15 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 305 QKLKPGRYWYDKESGLWGKE 324 >ref|XP_020240768.1| extra-large guanine nucleotide-binding protein 3 isoform X1 [Asparagus officinalis] Length = 870 Score = 69.3 bits (168), Expect(2) = 3e-15 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPD +VSSNLN +GKLSP+ASNGNT YI+GREITKV+L Sbjct: 328 GKEGEKPDRLVSSNLNFSGKLSPNASNGNTQVYINGREITKVEL 371 Score = 39.7 bits (91), Expect(2) = 3e-15 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 311 QKLKPGRYWYDKESGLWGKE 330 >ref|XP_020240770.1| extra-large guanine nucleotide-binding protein 3 isoform X2 [Asparagus officinalis] Length = 869 Score = 69.3 bits (168), Expect(2) = 3e-15 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPD +VSSNLN +GKLSP+ASNGNT YI+GREITKV+L Sbjct: 328 GKEGEKPDRLVSSNLNFSGKLSPNASNGNTQVYINGREITKVEL 371 Score = 39.7 bits (91), Expect(2) = 3e-15 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 311 QKLKPGRYWYDKESGLWGKE 330 >ref|XP_020240771.1| extra-large guanine nucleotide-binding protein 3 isoform X3 [Asparagus officinalis] gb|ONK58938.1| uncharacterized protein A4U43_C08F1280 [Asparagus officinalis] Length = 867 Score = 69.3 bits (168), Expect(2) = 3e-15 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPD +VSSNLN +GKLSP+ASNGNT YI+GREITKV+L Sbjct: 328 GKEGEKPDRLVSSNLNFSGKLSPNASNGNTQVYINGREITKVEL 371 Score = 39.7 bits (91), Expect(2) = 3e-15 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 311 QKLKPGRYWYDKESGLWGKE 330 >gb|OAP18477.1| XLG3 [Arabidopsis thaliana] Length = 848 Score = 69.3 bits (168), Expect(2) = 3e-15 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPD ++SSNLN TGKLSP ASNGNT YI+GREITK++L Sbjct: 307 GKEGEKPDRVISSNLNFTGKLSPDASNGNTEVYINGREITKLEL 350 Score = 39.7 bits (91), Expect(2) = 3e-15 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 290 QKLKPGRYWYDKESGLWGKE 309 >ref|XP_010540731.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Tarenaya hassleriana] Length = 848 Score = 69.3 bits (168), Expect(2) = 3e-15 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPD I+SSNLN TGKLSP ASNGNT YI+GREITK++L Sbjct: 317 GKEGEKPDRIISSNLNFTGKLSPHASNGNTEVYINGREITKLEL 360 Score = 39.7 bits (91), Expect(2) = 3e-15 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 300 QKLKPGRYWYDKESGLWGKE 319 >ref|NP_174475.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] ref|NP_849737.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] ref|NP_001185125.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] ref|NP_001319126.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] ref|NP_001320661.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] ref|NP_001320662.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] sp|Q9C516.1|XLG3_ARATH RecName: Full=Extra-large guanine nucleotide-binding protein 3; AltName: Full=Extra-large GTP-binding protein 3; Short=Extra-large G-protein 3 gb|AAG50710.1|AC079041_3 G-protein, putative [Arabidopsis thaliana] gb|AAG50792.1|AC074309_9 G-protein alpha subunit, putative [Arabidopsis thaliana] dbj|BAF01414.1| hypothetical protein [Arabidopsis thaliana] dbj|BAH19924.1| AT1G31930 [Arabidopsis thaliana] dbj|BAH20323.1| AT1G31930 [Arabidopsis thaliana] gb|ACT10805.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gb|AEE31417.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gb|AEE31418.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gb|AEE31419.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gb|ANM58207.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gb|ANM58208.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gb|ANM58209.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] Length = 848 Score = 69.3 bits (168), Expect(2) = 3e-15 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPD ++SSNLN TGKLSP ASNGNT YI+GREITK++L Sbjct: 307 GKEGEKPDRVISSNLNFTGKLSPDASNGNTEVYINGREITKLEL 350 Score = 39.7 bits (91), Expect(2) = 3e-15 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 290 QKLKPGRYWYDKESGLWGKE 309 >ref|XP_020868438.1| extra-large guanine nucleotide-binding protein 3 [Arabidopsis lyrata subsp. lyrata] gb|EFH67216.1| extra-large GTP-binding protein 3 [Arabidopsis lyrata subsp. lyrata] Length = 847 Score = 69.3 bits (168), Expect(2) = 3e-15 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPD ++SSNLN TGKLSP ASNGNT YI+GREITK++L Sbjct: 306 GKEGEKPDRVISSNLNFTGKLSPEASNGNTEVYINGREITKLEL 349 Score = 39.7 bits (91), Expect(2) = 3e-15 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 289 QKLKPGRYWYDKESGLWGKE 308 >ref|XP_022738946.1| extra-large guanine nucleotide-binding protein 3-like [Durio zibethinus] Length = 862 Score = 68.6 bits (166), Expect(2) = 4e-15 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPD I+SSNLN TGKL+P ASNGNT YI+GREITK++L Sbjct: 322 GKEGEKPDRIISSNLNFTGKLNPDASNGNTEVYINGREITKLEL 365 Score = 40.0 bits (92), Expect(2) = 4e-15 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 305 RKLKPGRYWYDKESGLWGKE 324 >gb|KJB51568.1| hypothetical protein B456_008G223200 [Gossypium raimondii] Length = 861 Score = 68.6 bits (166), Expect(2) = 4e-15 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPD I+SSNLN TGKL+P ASNGNT YI+GREITK++L Sbjct: 321 GKEGEKPDRIISSNLNFTGKLNPDASNGNTEVYINGREITKLEL 364 Score = 40.0 bits (92), Expect(2) = 4e-15 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 304 RKLKPGRYWYDKESGLWGKE 323 >ref|XP_016736562.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Gossypium hirsutum] ref|XP_016736563.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Gossypium hirsutum] ref|XP_016736564.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Gossypium hirsutum] Length = 860 Score = 68.6 bits (166), Expect(2) = 4e-15 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPD I+SSNLN TGKL+P ASNGNT YI+GREITK++L Sbjct: 321 GKEGEKPDRIISSNLNFTGKLNPDASNGNTEVYINGREITKLEL 364 Score = 40.0 bits (92), Expect(2) = 4e-15 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 304 RKLKPGRYWYDKESGLWGKE 323 >ref|XP_012439273.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Gossypium raimondii] ref|XP_012439274.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Gossypium raimondii] ref|XP_012439275.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Gossypium raimondii] gb|KJB51565.1| hypothetical protein B456_008G223200 [Gossypium raimondii] gb|KJB51566.1| hypothetical protein B456_008G223200 [Gossypium raimondii] gb|KJB51567.1| hypothetical protein B456_008G223200 [Gossypium raimondii] Length = 860 Score = 68.6 bits (166), Expect(2) = 4e-15 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 340 GKGEEKPDIIVSSNLNLTGKLSPSASNGNTHAYISGREITKVDL 471 GK EKPD I+SSNLN TGKL+P ASNGNT YI+GREITK++L Sbjct: 321 GKEGEKPDRIISSNLNFTGKLNPDASNGNTEVYINGREITKLEL 364 Score = 40.0 bits (92), Expect(2) = 4e-15 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 290 KKLKPLRYRYDKESGLWGKE 349 +KLKP RY YDKESGLWGKE Sbjct: 304 RKLKPGRYWYDKESGLWGKE 323