BLASTX nr result
ID: Ophiopogon24_contig00023499
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00023499 (444 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020269136.1| zinc finger CCCH domain-containing protein 4... 63 1e-08 gb|PKA62170.1| Zinc finger CCCH domain-containing protein 45 [Ap... 56 3e-06 ref|XP_020686552.1| zinc finger CCCH domain-containing protein 4... 55 5e-06 gb|PKU73321.1| Zinc finger CCCH domain-containing protein 45 [De... 55 5e-06 ref|XP_006846022.1| 30-kDa cleavage and polyadenylation specific... 55 5e-06 ref|XP_020686551.1| zinc finger CCCH domain-containing protein 4... 55 5e-06 ref|XP_020588276.1| zinc finger CCCH domain-containing protein 4... 55 5e-06 >ref|XP_020269136.1| zinc finger CCCH domain-containing protein 45 [Asparagus officinalis] gb|ONK65709.1| uncharacterized protein A4U43_C06F130 [Asparagus officinalis] Length = 603 Score = 62.8 bits (151), Expect = 1e-08 Identities = 31/40 (77%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = +3 Query: 3 SESEDEAAPRRSRYGDG-KKKRRESDGETGSDQWETPVTE 119 SESEDEAAPRRSRYG+G KKKR ES+ E GS+QWETP E Sbjct: 560 SESEDEAAPRRSRYGEGSKKKRWESEAEAGSEQWETPGPE 599 >gb|PKA62170.1| Zinc finger CCCH domain-containing protein 45 [Apostasia shenzhenica] Length = 718 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +3 Query: 3 SESEDEAAPRRSRYGDGKKKRRESDGETGSDQWETPVTEV 122 SES+DEAAPRRSR+GD KKRR S+GE ++ WETP++EV Sbjct: 677 SESDDEAAPRRSRHGD-SKKRRVSEGEGVAEHWETPLSEV 715 >ref|XP_020686552.1| zinc finger CCCH domain-containing protein 45 isoform X2 [Dendrobium catenatum] Length = 684 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = +3 Query: 3 SESEDEAAPRRSRYGDGKKKRRESDGETGSDQWETPVTE 119 SESEDE APRRSR+G+ KKRR S+GE +D WE P E Sbjct: 642 SESEDEPAPRRSRHGENSKKRRGSEGEPVADHWEAPFIE 680 >gb|PKU73321.1| Zinc finger CCCH domain-containing protein 45 [Dendrobium catenatum] Length = 690 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = +3 Query: 3 SESEDEAAPRRSRYGDGKKKRRESDGETGSDQWETPVTE 119 SESEDE APRRSR+G+ KKRR S+GE +D WE P E Sbjct: 648 SESEDEPAPRRSRHGENSKKRRGSEGEPVADHWEAPFIE 686 >ref|XP_006846022.1| 30-kDa cleavage and polyadenylation specificity factor 30 [Amborella trichopoda] gb|ERN07697.1| hypothetical protein AMTR_s00155p00079840 [Amborella trichopoda] Length = 701 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/40 (70%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = +3 Query: 3 SESEDEAAPRRSRYGDGKKKRRESDGE-TGSDQWETPVTE 119 SESEDEA PRRSR+G+G+KKRRE DGE SD WE P++E Sbjct: 659 SESEDEA-PRRSRHGEGRKKRREPDGEGEASDHWEMPLSE 697 >ref|XP_020686551.1| zinc finger CCCH domain-containing protein 45 isoform X1 [Dendrobium catenatum] Length = 713 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = +3 Query: 3 SESEDEAAPRRSRYGDGKKKRRESDGETGSDQWETPVTE 119 SESEDE APRRSR+G+ KKRR S+GE +D WE P E Sbjct: 671 SESEDEPAPRRSRHGENSKKRRGSEGEPVADHWEAPFIE 709 >ref|XP_020588276.1| zinc finger CCCH domain-containing protein 45 [Phalaenopsis equestris] Length = 713 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +3 Query: 3 SESEDEAAPRRSRYGDGKKKRRESDGETGSDQWETPVTE 119 SESEDEAAPRRSR+G+ KKRR S+G+ +D WE P TE Sbjct: 672 SESEDEAAPRRSRHGE-SKKRRGSEGDVAADHWEAPFTE 709