BLASTX nr result
ID: Ophiopogon24_contig00023458
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00023458 (498 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKA66387.1| hypothetical protein AXF42_Ash007084 [Apostasia s... 58 3e-08 ref|XP_020276829.1| uncharacterized protein LOC109851201 isoform... 56 2e-07 ref|XP_020276828.1| uncharacterized protein LOC109851201 isoform... 56 3e-07 ref|XP_020582026.1| uncharacterized protein LOC110025736 [Phalae... 55 1e-06 >gb|PKA66387.1| hypothetical protein AXF42_Ash007084 [Apostasia shenzhenica] Length = 81 Score = 58.2 bits (139), Expect = 3e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +2 Query: 2 VRNHEIAIGELNGLSAAKGVYQKVGNIFFRKDIET 106 +RNHEIAIGELN LSA+ VYQK+GNI+FRK IE+ Sbjct: 24 IRNHEIAIGELNSLSASSVVYQKIGNIYFRKSIES 58 >ref|XP_020276829.1| uncharacterized protein LOC109851201 isoform X2 [Asparagus officinalis] Length = 84 Score = 55.8 bits (133), Expect = 2e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +2 Query: 2 VRNHEIAIGELNGLSAAKGVYQKVGNIFFRKDIET 106 +R HE+AI ELN L +KGVYQK GNIFFRKD+ET Sbjct: 28 IRCHEVAIVELNALPPSKGVYQKAGNIFFRKDVET 62 >ref|XP_020276828.1| uncharacterized protein LOC109851201 isoform X1 [Asparagus officinalis] Length = 96 Score = 55.8 bits (133), Expect = 3e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +2 Query: 2 VRNHEIAIGELNGLSAAKGVYQKVGNIFFRKDIET 106 +R HE+AI ELN L +KGVYQK GNIFFRKD+ET Sbjct: 28 IRCHEVAIVELNALPPSKGVYQKAGNIFFRKDVET 62 >ref|XP_020582026.1| uncharacterized protein LOC110025736 [Phalaenopsis equestris] Length = 107 Score = 54.7 bits (130), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +2 Query: 2 VRNHEIAIGELNGLSAAKGVYQKVGNIFFRKDIE 103 +RNHEIAIGEL+ LSA++ VY K+GNI+FR+ IE Sbjct: 27 IRNHEIAIGELDSLSASRAVYHKIGNIYFRRSIE 60