BLASTX nr result
ID: Ophiopogon24_contig00023341
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00023341 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010267026.1| PREDICTED: far upstream element-binding prot... 59 3e-07 >ref|XP_010267026.1| PREDICTED: far upstream element-binding protein 1-like [Nelumbo nucifera] Length = 740 Score = 58.9 bits (141), Expect = 3e-07 Identities = 33/49 (67%), Positives = 35/49 (71%), Gaps = 8/49 (16%) Frame = +3 Query: 87 YGGAYSQPSAYSTESAA----HGAYDAPSASPAVP----TGVAKASPQS 209 YGG YSQPSAYST+SAA HG YDA S AVP +GVAKASPQS Sbjct: 692 YGGGYSQPSAYSTDSAAGGSVHGTYDAAPGSQAVPPVQQSGVAKASPQS 740