BLASTX nr result
ID: Ophiopogon24_contig00023277
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00023277 (372 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009386752.1| PREDICTED: 40S ribosomal protein S25-like [M... 64 2e-10 ref|XP_009379810.1| PREDICTED: 40S ribosomal protein S25-like [M... 64 2e-10 ref|XP_009408282.1| PREDICTED: 40S ribosomal protein S25 [Musa a... 63 2e-10 ref|XP_020106717.1| 40S ribosomal protein S25-like [Ananas comos... 62 6e-10 ref|XP_020111584.1| 40S ribosomal protein S25-4-like [Ananas com... 62 6e-10 ref|XP_010931124.1| PREDICTED: 40S ribosomal protein S25 isoform... 62 9e-10 ref|XP_010927799.1| PREDICTED: 40S ribosomal protein S25-like [E... 62 9e-10 ref|XP_009390753.1| PREDICTED: 40S ribosomal protein S25-like [M... 62 9e-10 ref|XP_008776574.1| PREDICTED: 40S ribosomal protein S25-like [P... 62 9e-10 ref|XP_008788953.1| PREDICTED: 40S ribosomal protein S25-like [P... 62 9e-10 ref|XP_008787649.1| PREDICTED: 40S ribosomal protein S25-like [P... 62 9e-10 ref|XP_010926874.1| PREDICTED: 40S ribosomal protein S25 [Elaeis... 61 1e-09 ref|XP_020260371.1| 40S ribosomal protein S25-2 [Asparagus offic... 61 2e-09 ref|XP_020248167.1| 40S ribosomal protein S25-2-like [Asparagus ... 61 2e-09 gb|ACN25228.1| unknown [Zea mays] >gi|1142679183|gb|ONM37226.1| ... 60 2e-09 ref|XP_020253259.1| 40S ribosomal protein S25-4-like [Asparagus ... 60 2e-09 ref|XP_008653996.1| 40S ribosomal protein S25-3 [Zea mays] >gi|1... 60 3e-09 gb|PAN10997.1| hypothetical protein PAHAL_B01922, partial [Panic... 60 3e-09 gb|PAN36702.1| hypothetical protein PAHAL_F00361 [Panicum hallii] 60 3e-09 ref|XP_009390036.1| PREDICTED: 40S ribosomal protein S25-4 [Musa... 60 3e-09 >ref|XP_009386752.1| PREDICTED: 40S ribosomal protein S25-like [Musa acuminata subsp. malaccensis] Length = 108 Score = 63.5 bits (153), Expect = 2e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN AV FDQ NY KMLSEVPKYKQITPSV+SER Sbjct: 34 KEKVNNAVLFDQANYDKMLSEVPKYKQITPSVLSER 69 >ref|XP_009379810.1| PREDICTED: 40S ribosomal protein S25-like [Musa acuminata subsp. malaccensis] Length = 108 Score = 63.5 bits (153), Expect = 2e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN AV FDQ NY KMLSEVPKYKQITPSV+SER Sbjct: 34 KEKVNNAVLFDQANYDKMLSEVPKYKQITPSVLSER 69 >ref|XP_009408282.1| PREDICTED: 40S ribosomal protein S25 [Musa acuminata subsp. malaccensis] Length = 108 Score = 63.2 bits (152), Expect = 2e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN A+ FDQ NY KMLSEVPKYKQITPSV+SER Sbjct: 34 KEKVNNAILFDQANYDKMLSEVPKYKQITPSVLSER 69 >ref|XP_020106717.1| 40S ribosomal protein S25-like [Ananas comosus] gb|OAY71691.1| 40S ribosomal protein S25-4 [Ananas comosus] Length = 108 Score = 62.0 bits (149), Expect = 6e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN AV FDQ NY KMLSEVPK+KQITPSV+SER Sbjct: 34 KEKVNNAVLFDQANYDKMLSEVPKFKQITPSVLSER 69 >ref|XP_020111584.1| 40S ribosomal protein S25-4-like [Ananas comosus] gb|OAY63959.1| 40S ribosomal protein S25-4 [Ananas comosus] gb|OAY73817.1| 40S ribosomal protein S25-4 [Ananas comosus] Length = 108 Score = 62.0 bits (149), Expect = 6e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN AV FDQ NY KMLSEVPK+KQITPSV+SER Sbjct: 34 KEKVNNAVLFDQANYDKMLSEVPKFKQITPSVLSER 69 >ref|XP_010931124.1| PREDICTED: 40S ribosomal protein S25 isoform X1 [Elaeis guineensis] Length = 108 Score = 61.6 bits (148), Expect = 9e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN AV FDQ +Y KMLSEVPKYKQITPSV+SER Sbjct: 34 KEKVNNAVLFDQASYDKMLSEVPKYKQITPSVLSER 69 >ref|XP_010927799.1| PREDICTED: 40S ribosomal protein S25-like [Elaeis guineensis] Length = 108 Score = 61.6 bits (148), Expect = 9e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN AV FDQ +Y KMLSEVPKYKQITPSV+SER Sbjct: 34 KEKVNNAVLFDQASYDKMLSEVPKYKQITPSVLSER 69 >ref|XP_009390753.1| PREDICTED: 40S ribosomal protein S25-like [Musa acuminata subsp. malaccensis] Length = 108 Score = 61.6 bits (148), Expect = 9e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN AV FDQ +Y KMLSEVPKYKQITPSV+SER Sbjct: 34 KEKVNNAVLFDQASYDKMLSEVPKYKQITPSVLSER 69 >ref|XP_008776574.1| PREDICTED: 40S ribosomal protein S25-like [Phoenix dactylifera] Length = 108 Score = 61.6 bits (148), Expect = 9e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN AV FDQ +Y KMLSEVPKYKQITPSV+SER Sbjct: 34 KEKVNNAVLFDQASYDKMLSEVPKYKQITPSVLSER 69 >ref|XP_008788953.1| PREDICTED: 40S ribosomal protein S25-like [Phoenix dactylifera] Length = 108 Score = 61.6 bits (148), Expect = 9e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN AV FDQ +Y KMLSEVPKYKQITPSV+SER Sbjct: 34 KEKVNNAVLFDQASYDKMLSEVPKYKQITPSVLSER 69 >ref|XP_008787649.1| PREDICTED: 40S ribosomal protein S25-like [Phoenix dactylifera] Length = 108 Score = 61.6 bits (148), Expect = 9e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN AV FDQ +Y KMLSEVPKYKQITPSV+SER Sbjct: 34 KEKVNNAVLFDQASYDKMLSEVPKYKQITPSVLSER 69 >ref|XP_010926874.1| PREDICTED: 40S ribosomal protein S25 [Elaeis guineensis] Length = 108 Score = 61.2 bits (147), Expect = 1e-09 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN AV FDQ Y KMLSEVPKYKQITPSV+SER Sbjct: 34 KEKVNNAVLFDQATYDKMLSEVPKYKQITPSVLSER 69 >ref|XP_020260371.1| 40S ribosomal protein S25-2 [Asparagus officinalis] gb|ONK71290.1| uncharacterized protein A4U43_C04F6950 [Asparagus officinalis] Length = 109 Score = 60.8 bits (146), Expect = 2e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN AV FDQ +Y KMLSEVPKYKQITPSV+SER Sbjct: 35 KEKVNNAVLFDQGSYDKMLSEVPKYKQITPSVLSER 70 >ref|XP_020248167.1| 40S ribosomal protein S25-2-like [Asparagus officinalis] gb|ONK57143.1| uncharacterized protein A4U43_C10F17050 [Asparagus officinalis] Length = 109 Score = 60.8 bits (146), Expect = 2e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN AV FDQ +Y KMLSEVPKYKQITPSV+SER Sbjct: 35 KEKVNNAVLFDQGSYDKMLSEVPKYKQITPSVLSER 70 >gb|ACN25228.1| unknown [Zea mays] gb|ONM37226.1| 40S ribosomal protein S25-2 [Zea mays] Length = 91 Score = 60.1 bits (144), Expect = 2e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN AV FDQ Y K+LSEVPKYKQITPSV+SER Sbjct: 34 KEKVNNAVLFDQATYDKLLSEVPKYKQITPSVLSER 69 >ref|XP_020253259.1| 40S ribosomal protein S25-4-like [Asparagus officinalis] gb|ONK77582.1| uncharacterized protein A4U43_C02F8130 [Asparagus officinalis] Length = 109 Score = 60.5 bits (145), Expect = 2e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN AV FDQ +Y KML+EVPKYKQITPSV+SER Sbjct: 35 KEKVNNAVLFDQASYDKMLTEVPKYKQITPSVLSER 70 >ref|XP_008653996.1| 40S ribosomal protein S25-3 [Zea mays] gb|ONL96316.1| 40S ribosomal protein S25-2 [Zea mays] Length = 96 Score = 60.1 bits (144), Expect = 3e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN AV FDQ Y K+LSEVPKYKQITPSV+SER Sbjct: 34 KEKVNNAVLFDQATYDKLLSEVPKYKQITPSVLSER 69 >gb|PAN10997.1| hypothetical protein PAHAL_B01922, partial [Panicum hallii] Length = 107 Score = 60.1 bits (144), Expect = 3e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN AV FDQ Y K+LSEVPKYKQITPSV+SER Sbjct: 33 KEKVNNAVLFDQATYDKLLSEVPKYKQITPSVLSER 68 >gb|PAN36702.1| hypothetical protein PAHAL_F00361 [Panicum hallii] Length = 108 Score = 60.1 bits (144), Expect = 3e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN AV FDQ Y K+LSEVPKYKQITPSV+SER Sbjct: 34 KEKVNNAVLFDQATYDKLLSEVPKYKQITPSVLSER 69 >ref|XP_009390036.1| PREDICTED: 40S ribosomal protein S25-4 [Musa acuminata subsp. malaccensis] Length = 108 Score = 60.1 bits (144), Expect = 3e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 3 KEKVNTAVHFDQTNYVKMLSEVPKYKQITPSVISER 110 KEKVN AV FDQ +Y KMLSEVPK+KQITPSV+SER Sbjct: 34 KEKVNNAVLFDQASYDKMLSEVPKFKQITPSVLSER 69