BLASTX nr result
ID: Ophiopogon24_contig00023141
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00023141 (533 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021835947.1| actin-related protein 7-like [Spinacia olera... 58 1e-06 ref|XP_019103573.1| PREDICTED: actin-related protein 7 isoform X... 56 4e-06 ref|XP_021762393.1| actin-related protein 7-like [Chenopodium qu... 56 5e-06 ref|XP_010670533.1| PREDICTED: actin-related protein 7 isoform X... 56 5e-06 >ref|XP_021835947.1| actin-related protein 7-like [Spinacia oleracea] gb|KNA12692.1| hypothetical protein SOVF_123650 [Spinacia oleracea] Length = 361 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +2 Query: 2 SSVSSENHRQLLENTVLCGGTACMTGYKAT*SRKC 106 S+VSSENHRQLLENTVLCGGT+CMTG++ ++C Sbjct: 264 STVSSENHRQLLENTVLCGGTSCMTGFEDRFQKEC 298 >ref|XP_019103573.1| PREDICTED: actin-related protein 7 isoform X2 [Beta vulgaris subsp. vulgaris] Length = 312 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = +2 Query: 2 SSVSSENHRQLLENTVLCGGTACMTGYK 85 S+VSSENHRQLLENTVLCGGT+CMTG++ Sbjct: 264 STVSSENHRQLLENTVLCGGTSCMTGFE 291 >ref|XP_021762393.1| actin-related protein 7-like [Chenopodium quinoa] Length = 361 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +2 Query: 2 SSVSSENHRQLLENTVLCGGTACMTGYKAT*SRKC 106 S+VSSENHRQLLENTVLCGGT+CM G++ ++C Sbjct: 264 STVSSENHRQLLENTVLCGGTSCMAGFEDRFQKEC 298 >ref|XP_010670533.1| PREDICTED: actin-related protein 7 isoform X1 [Beta vulgaris subsp. vulgaris] gb|KMT16986.1| hypothetical protein BVRB_2g041910 [Beta vulgaris subsp. vulgaris] Length = 361 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = +2 Query: 2 SSVSSENHRQLLENTVLCGGTACMTGYK 85 S+VSSENHRQLLENTVLCGGT+CMTG++ Sbjct: 264 STVSSENHRQLLENTVLCGGTSCMTGFE 291