BLASTX nr result
ID: Ophiopogon24_contig00022908
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00022908 (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIA27077.1| hypothetical protein AQUCO_08300044v1 [Aquilegia ... 59 1e-07 gb|KJB47365.1| hypothetical protein B456_008G022900 [Gossypium r... 59 1e-07 ref|XP_020702171.1| protein unc-50 homolog [Dendrobium catenatum] 57 2e-07 ref|XP_020102886.1| protein unc-50 homolog isoform X2 [Ananas co... 57 3e-07 ref|XP_019701518.1| PREDICTED: protein unc-50 homolog [Elaeis gu... 55 3e-07 ref|XP_020102885.1| protein unc-50 homolog isoform X1 [Ananas co... 57 4e-07 gb|OAY66257.1| hypothetical protein ACMD2_16662 [Ananas comosus] 57 4e-07 ref|XP_021750769.1| protein unc-50 homolog [Chenopodium quinoa] 57 5e-07 ref|XP_021753409.1| protein unc-50 homolog [Chenopodium quinoa] 57 5e-07 ref|XP_020265562.1| protein unc-50 homolog [Asparagus officinalis] 57 7e-07 ref|XP_018858685.1| PREDICTED: protein unc-50 homolog, partial [... 57 9e-07 ref|XP_022896137.1| protein unc-50 homolog [Olea europaea var. s... 56 1e-06 gb|ONK70302.1| uncharacterized protein A4U43_C05F32330 [Asparagu... 57 1e-06 ref|XP_008799595.1| PREDICTED: protein unc-50 homolog [Phoenix d... 55 2e-06 dbj|GAY66608.1| hypothetical protein CUMW_250140 [Citrus unshiu] 55 2e-06 ref|XP_021851070.1| protein unc-50 homolog [Spinacia oleracea] >... 55 2e-06 ref|XP_012831078.1| PREDICTED: protein unc-50 homolog [Erythrant... 55 2e-06 gb|ESR36171.1| hypothetical protein CICLE_v10029109mg [Citrus cl... 55 2e-06 ref|XP_010271213.1| PREDICTED: protein unc-50 homolog isoform X2... 55 2e-06 ref|XP_018858358.1| PREDICTED: protein unc-50 homolog, partial [... 54 2e-06 >gb|PIA27077.1| hypothetical protein AQUCO_08300044v1 [Aquilegia coerulea] gb|PIA27078.1| hypothetical protein AQUCO_08300044v1 [Aquilegia coerulea] Length = 248 Score = 58.5 bits (140), Expect = 1e-07 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FL 138 VIHY V+ L + PVLLS LLFMAAISYYHYLNFLGY + FL Sbjct: 166 VIHYFVSPLLVAHGFIPVLLSNLLFMAAISYYHYLNFLGYDVLPFL 211 >gb|KJB47365.1| hypothetical protein B456_008G022900 [Gossypium raimondii] Length = 257 Score = 58.5 bits (140), Expect = 1e-07 Identities = 30/52 (57%), Positives = 35/52 (67%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FLCLHVYL 156 VIHY V+ L + P LLS LLFM A SYYHYLNFLGY G +CLH ++ Sbjct: 179 VIHYFVSPLLVAHGFIPELLSNLLFMVAASYYHYLNFLGYDGK-LICLHFFI 229 >ref|XP_020702171.1| protein unc-50 homolog [Dendrobium catenatum] Length = 156 Score = 57.0 bits (136), Expect = 2e-07 Identities = 40/88 (45%), Positives = 50/88 (56%), Gaps = 1/88 (1%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FLCLHVYLCACFQAFF 180 V+HY V+ L + FPVLLS LLFM AISYY+YLNFLGY + FL FF Sbjct: 73 VVHYFVSPLLVAHGFFPVLLSNLLFMVAISYYNYLNFLGYDVLPFLDR--------TTFF 124 Query: 181 LYH-GM*FL*WLRDEQVLLRTFNVTRFL 261 LY G+ + ++L FN TR+L Sbjct: 125 LYPIGLVI---ILSPLLILTGFNPTRYL 149 >ref|XP_020102886.1| protein unc-50 homolog isoform X2 [Ananas comosus] Length = 218 Score = 57.4 bits (137), Expect = 3e-07 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FL 138 VIHY ++ + + FPVLLS LLFM AISYYHYLNFLGY + FL Sbjct: 136 VIHYFLSPILVAHGFFPVLLSNLLFMVAISYYHYLNFLGYDVLPFL 181 >ref|XP_019701518.1| PREDICTED: protein unc-50 homolog [Elaeis guineensis] Length = 89 Score = 54.7 bits (130), Expect = 3e-07 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FL 138 VI Y V+ + + FPVLLS LLFM AISYYHYLNF+GY + FL Sbjct: 7 VIQYFVSPILVAHGFFPVLLSNLLFMVAISYYHYLNFIGYDVLPFL 52 >ref|XP_020102885.1| protein unc-50 homolog isoform X1 [Ananas comosus] Length = 250 Score = 57.4 bits (137), Expect = 4e-07 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FL 138 VIHY ++ + + FPVLLS LLFM AISYYHYLNFLGY + FL Sbjct: 168 VIHYFLSPILVAHGFFPVLLSNLLFMVAISYYHYLNFLGYDVLPFL 213 >gb|OAY66257.1| hypothetical protein ACMD2_16662 [Ananas comosus] Length = 250 Score = 57.4 bits (137), Expect = 4e-07 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FL 138 VIHY ++ + + FPVLLS LLFM AISYYHYLNFLGY + FL Sbjct: 168 VIHYFLSPILVAHGFFPVLLSNLLFMVAISYYHYLNFLGYDVLPFL 213 >ref|XP_021750769.1| protein unc-50 homolog [Chenopodium quinoa] Length = 252 Score = 57.0 bits (136), Expect = 5e-07 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FL 138 VIHY ++ L + PVLLS LLFMAA+SYYHYLNFLGY + FL Sbjct: 167 VIHYFLSPLLLAHGFIPVLLSNLLFMAAVSYYHYLNFLGYDVLPFL 212 >ref|XP_021753409.1| protein unc-50 homolog [Chenopodium quinoa] Length = 252 Score = 57.0 bits (136), Expect = 5e-07 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FL 138 VIHY ++ L + PVLLS LLFMAA+SYYHYLNFLGY + FL Sbjct: 167 VIHYFLSPLLLAHGFIPVLLSNLLFMAAVSYYHYLNFLGYDVLPFL 212 >ref|XP_020265562.1| protein unc-50 homolog [Asparagus officinalis] Length = 248 Score = 56.6 bits (135), Expect = 7e-07 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FL 138 VI Y V+ + ++ FPVLLS LLFM AISYYHYLNFLGY + FL Sbjct: 166 VIQYFVSPILAAHGFFPVLLSNLLFMVAISYYHYLNFLGYDVLPFL 211 >ref|XP_018858685.1| PREDICTED: protein unc-50 homolog, partial [Juglans regia] Length = 296 Score = 56.6 bits (135), Expect = 9e-07 Identities = 31/60 (51%), Positives = 38/60 (63%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FLCLHVYLCACFQAFF 180 VIHY ++ L + P+LLS LLFMAA SYYHYLNFLGY G ++L CF+ F Sbjct: 187 VIHYFLSPLLVAHGFIPMLLSNLLFMAAASYYHYLNFLGYDGK---LTSLFLPVCFKHSF 243 >ref|XP_022896137.1| protein unc-50 homolog [Olea europaea var. sylvestris] Length = 254 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FL 138 V+HY ++ L + PVLLS LLFMAAISYYHYLNFLGY + FL Sbjct: 169 VLHYFLSPLLVAHGFVPVLLSNLLFMAAISYYHYLNFLGYDVLPFL 214 >gb|ONK70302.1| uncharacterized protein A4U43_C05F32330 [Asparagus officinalis] Length = 433 Score = 56.6 bits (135), Expect = 1e-06 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FL 138 VI Y V+ + ++ FPVLLS LLFM AISYYHYLNFLGY + FL Sbjct: 166 VIQYFVSPILAAHGFFPVLLSNLLFMVAISYYHYLNFLGYDVLPFL 211 >ref|XP_008799595.1| PREDICTED: protein unc-50 homolog [Phoenix dactylifera] ref|XP_017700419.1| PREDICTED: protein unc-50 homolog [Phoenix dactylifera] Length = 248 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FL 138 VI Y V+ + + FPVLLS LLFM AISYYHYLNFLGY + FL Sbjct: 166 VIQYFVSPILVAHGFFPVLLSNLLFMVAISYYHYLNFLGYDVLPFL 211 >dbj|GAY66608.1| hypothetical protein CUMW_250140 [Citrus unshiu] Length = 250 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/52 (57%), Positives = 33/52 (63%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FLCLHVYL 156 +IHY ++ L PVLLS LLFMAA SYYHYLNFLGY G L YL Sbjct: 139 IIHYFLSPLLMVHGFIPVLLSNLLFMAAASYYHYLNFLGYDGKLILLKIEYL 190 >ref|XP_021851070.1| protein unc-50 homolog [Spinacia oleracea] gb|KNA06638.1| hypothetical protein SOVF_179200 [Spinacia oleracea] Length = 252 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FL 138 VIHY ++ L + PVLLS LLFM A+SYYHYLNFLGY + FL Sbjct: 167 VIHYFLSPLLLAHGFIPVLLSNLLFMVAVSYYHYLNFLGYDVLPFL 212 >ref|XP_012831078.1| PREDICTED: protein unc-50 homolog [Erythranthe guttata] gb|EYU42697.1| hypothetical protein MIMGU_mgv1a012334mg [Erythranthe guttata] Length = 253 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FL 138 VIHY ++ L + PVLLS LLFMAA+SYYHYLN+LGY + FL Sbjct: 168 VIHYFLSPLLVAHGFVPVLLSNLLFMAAVSYYHYLNYLGYDVLPFL 213 >gb|ESR36171.1| hypothetical protein CICLE_v10029109mg [Citrus clementina] Length = 254 Score = 55.5 bits (132), Expect = 2e-06 Identities = 32/56 (57%), Positives = 34/56 (60%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FLCLHVYLCACF 168 VIHY ++ L PVLLS LLFMAA SYYHYLNFLGY G L L CF Sbjct: 168 VIHYFLSPLLMVHGFIPVLLSNLLFMAAASYYHYLNFLGYDGKLIL-----LVCCF 218 >ref|XP_010271213.1| PREDICTED: protein unc-50 homolog isoform X2 [Nelumbo nucifera] Length = 216 Score = 55.1 bits (131), Expect = 2e-06 Identities = 38/88 (43%), Positives = 50/88 (56%), Gaps = 1/88 (1%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FLCLHVYLCACFQAFF 180 VIHY ++ L + P+LLS L+FM AISYYHYLNFLGY + FL FF Sbjct: 134 VIHYFLSPLLVAHGFIPLLLSNLVFMVAISYYHYLNFLGYDVLPFLDK--------TTFF 185 Query: 181 LYH-GM*FL*WLRDEQVLLRTFNVTRFL 261 LY G+ F + ++L FN TR++ Sbjct: 186 LYPIGLVF---IISPLLILSGFNPTRYV 210 >ref|XP_018858358.1| PREDICTED: protein unc-50 homolog, partial [Juglans regia] Length = 179 Score = 54.3 bits (129), Expect = 2e-06 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = +1 Query: 1 VIHYCVNYLGSSRFIFPVLLSILLFMAAISYYHYLNFLGYHGM*FL 138 VIHY ++ L + P+LLS LLFMAA SYYHYLNFLGY + FL Sbjct: 91 VIHYFLSPLLVAHGFIPMLLSNLLFMAAASYYHYLNFLGYDVLPFL 136