BLASTX nr result
ID: Ophiopogon24_contig00022753
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00022753 (395 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247145.1| phosphatidylinositol 4-phosphate 5-kinase 9-... 74 8e-13 ref|XP_020260026.1| phosphatidylinositol 4-phosphate 5-kinase 9-... 57 7e-07 >ref|XP_020247145.1| phosphatidylinositol 4-phosphate 5-kinase 9-like [Asparagus officinalis] ref|XP_020247146.1| phosphatidylinositol 4-phosphate 5-kinase 9-like [Asparagus officinalis] ref|XP_020247147.1| phosphatidylinositol 4-phosphate 5-kinase 9-like [Asparagus officinalis] gb|ONK57275.1| uncharacterized protein A4U43_C10F18400 [Asparagus officinalis] Length = 830 Score = 74.3 bits (181), Expect = 8e-13 Identities = 37/53 (69%), Positives = 42/53 (79%) Frame = -1 Query: 161 MSAPVVFDDDNKGASCSERGGRLCRDISCVSDRVLSFHLANGQASFSSTETVG 3 MS PVV DD NKGASCS R RLC D+SC+S++ LSFH ANGQAS S+ETVG Sbjct: 1 MSVPVVTDDHNKGASCSGRA-RLCHDVSCISEKALSFHSANGQASPLSSETVG 52 >ref|XP_020260026.1| phosphatidylinositol 4-phosphate 5-kinase 9-like [Asparagus officinalis] ref|XP_020260027.1| phosphatidylinositol 4-phosphate 5-kinase 9-like [Asparagus officinalis] gb|ONK70985.1| uncharacterized protein A4U43_C04F3530 [Asparagus officinalis] Length = 822 Score = 57.4 bits (137), Expect = 7e-07 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = -1 Query: 161 MSAPVVFDDDNKGASCSERGGRLCRDISCVSDRVLSFHLANGQASFSSTETVG 3 MS PVVFDD N GASCSER LCRD+SCVS++++S +L ++ETVG Sbjct: 1 MSVPVVFDDGNNGASCSER-STLCRDVSCVSEKLVSLNL--------NSETVG 44