BLASTX nr result
ID: Ophiopogon24_contig00022501
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00022501 (1297 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244965.1| LOW QUALITY PROTEIN: receptor-like protein k... 60 5e-06 gb|ONK80132.1| uncharacterized protein A4U43_C01F14230 [Asparagu... 60 6e-06 >ref|XP_020244965.1| LOW QUALITY PROTEIN: receptor-like protein kinase HSL1 [Asparagus officinalis] Length = 982 Score = 60.5 bits (145), Expect = 5e-06 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 2/49 (4%) Frame = +3 Query: 1095 LVRWVCITME--GMGYVFNPNLDISLFMDTNYKVLSMGFQCTSNLPMNR 1235 LV+WVC T+E G +V +PNLD SLF + KVL++G CTSNLPMNR Sbjct: 886 LVKWVCSTLEQKGADHVIDPNLDTSLFKEELNKVLNIGLHCTSNLPMNR 934 >gb|ONK80132.1| uncharacterized protein A4U43_C01F14230 [Asparagus officinalis] Length = 1097 Score = 60.5 bits (145), Expect = 6e-06 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 2/49 (4%) Frame = +3 Query: 1095 LVRWVCITME--GMGYVFNPNLDISLFMDTNYKVLSMGFQCTSNLPMNR 1235 LV+WVC T+E G +V +PNLD SLF + KVL++G CTSNLPMNR Sbjct: 865 LVKWVCSTLEQKGADHVIDPNLDTSLFKEELNKVLNIGLHCTSNLPMNR 913