BLASTX nr result
ID: Ophiopogon24_contig00022272
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00022272 (931 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008798244.1| PREDICTED: pentatricopeptide repeat-containi... 56 1e-10 ref|XP_010941649.1| PREDICTED: pentatricopeptide repeat-containi... 56 2e-10 gb|OIT06240.1| pentatricopeptide repeat-containing protein [Nico... 56 4e-10 ref|XP_015159761.1| PREDICTED: pentatricopeptide repeat-containi... 56 4e-10 ref|XP_019228505.1| PREDICTED: pentatricopeptide repeat-containi... 56 4e-10 ref|XP_016559208.1| PREDICTED: pentatricopeptide repeat-containi... 56 4e-10 ref|XP_015066664.1| PREDICTED: pentatricopeptide repeat-containi... 56 4e-10 ref|XP_009792923.1| PREDICTED: pentatricopeptide repeat-containi... 56 4e-10 ref|XP_016451478.1| PREDICTED: pentatricopeptide repeat-containi... 56 4e-10 ref|XP_006365038.1| PREDICTED: pentatricopeptide repeat-containi... 56 4e-10 ref|XP_004233239.1| PREDICTED: pentatricopeptide repeat-containi... 56 4e-10 gb|PHT89812.1| Pentatricopeptide repeat-containing protein, part... 56 4e-10 ref|XP_009792924.1| PREDICTED: pentatricopeptide repeat-containi... 56 4e-10 gb|PHU25678.1| Pentatricopeptide repeat-containing protein, part... 56 4e-10 ref|XP_018684405.1| PREDICTED: pentatricopeptide repeat-containi... 55 9e-10 gb|KRG90712.1| hypothetical protein GLYMA_20G109800 [Glycine max] 55 2e-09 ref|XP_003555869.1| PREDICTED: pentatricopeptide repeat-containi... 55 2e-09 gb|PHT55338.1| Pentatricopeptide repeat-containing protein, part... 54 2e-09 ref|XP_006605878.1| PREDICTED: pentatricopeptide repeat-containi... 55 2e-09 ref|XP_020244921.1| pentatricopeptide repeat-containing protein ... 55 2e-09 >ref|XP_008798244.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 [Phoenix dactylifera] Length = 605 Score = 56.2 bits (134), Expect(2) = 1e-10 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVKT 169 PDGGTAKV +SCS ++Q EQVTTI+RSMHKE +T Sbjct: 567 PDGGTAKVLLSSCSNEEQMEQVTTIVRSMHKEART 601 Score = 39.3 bits (90), Expect(2) = 1e-10 Identities = 18/22 (81%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 YSRKKQY KCLEIFEEM+ GC Sbjct: 544 YSRKKQYKKCLEIFEEMIDAGC 565 >ref|XP_010941649.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 [Elaeis guineensis] Length = 601 Score = 56.2 bits (134), Expect(2) = 2e-10 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVKT 169 PDGGTAKV +SCS ++Q EQVTTI+RSMHKE +T Sbjct: 563 PDGGTAKVLLSSCSSEEQMEQVTTIVRSMHKEART 597 Score = 38.5 bits (88), Expect(2) = 2e-10 Identities = 18/22 (81%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 YSR+KQY KCLEIFEEMV GC Sbjct: 540 YSRRKQYKKCLEIFEEMVDAGC 561 >gb|OIT06240.1| pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 611 Score = 56.2 bits (134), Expect(2) = 4e-10 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVKT 169 PDGGTAKV +SCS + Q EQVTT+IRSMHK VKT Sbjct: 573 PDGGTAKVLLSSCSSEDQIEQVTTVIRSMHKNVKT 607 Score = 37.4 bits (85), Expect(2) = 4e-10 Identities = 16/22 (72%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 YS+KKQY +CLEIFEEM+ GC Sbjct: 550 YSKKKQYQRCLEIFEEMIDEGC 571 >ref|XP_015159761.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 isoform X1 [Solanum tuberosum] Length = 580 Score = 56.2 bits (134), Expect(2) = 4e-10 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVKT 169 PDGGTAKV +SCS + Q EQVTT+IRSMHK VKT Sbjct: 542 PDGGTAKVLLSSCSSEDQIEQVTTVIRSMHKNVKT 576 Score = 37.4 bits (85), Expect(2) = 4e-10 Identities = 16/22 (72%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 YS+KKQY +CLEIFEEM+ GC Sbjct: 519 YSKKKQYQRCLEIFEEMIDEGC 540 >ref|XP_019228505.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 [Nicotiana attenuata] Length = 576 Score = 56.2 bits (134), Expect(2) = 4e-10 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVKT 169 PDGGTAKV +SCS + Q EQVTT+IRSMHK VKT Sbjct: 538 PDGGTAKVLLSSCSSEDQIEQVTTVIRSMHKNVKT 572 Score = 37.4 bits (85), Expect(2) = 4e-10 Identities = 16/22 (72%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 YS+KKQY +CLEIFEEM+ GC Sbjct: 515 YSKKKQYQRCLEIFEEMIDEGC 536 >ref|XP_016559208.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 [Capsicum annuum] Length = 576 Score = 56.2 bits (134), Expect(2) = 4e-10 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVKT 169 PDGGTAKV +SCS + Q EQVTT+IRSMHK VKT Sbjct: 538 PDGGTAKVLLSSCSSEDQIEQVTTVIRSMHKNVKT 572 Score = 37.4 bits (85), Expect(2) = 4e-10 Identities = 16/22 (72%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 YS+KKQY +CLEIFEEM+ GC Sbjct: 515 YSKKKQYQRCLEIFEEMIDEGC 536 >ref|XP_015066664.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 [Solanum pennellii] Length = 576 Score = 56.2 bits (134), Expect(2) = 4e-10 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVKT 169 PDGGTAKV +SCS + Q EQVTT+IRSMHK VKT Sbjct: 538 PDGGTAKVLLSSCSSEDQIEQVTTVIRSMHKNVKT 572 Score = 37.4 bits (85), Expect(2) = 4e-10 Identities = 16/22 (72%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 YS+KKQY +CLEIFEEM+ GC Sbjct: 515 YSKKKQYQRCLEIFEEMIDEGC 536 >ref|XP_009792923.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 isoform X1 [Nicotiana sylvestris] ref|XP_016503040.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130-like isoform X1 [Nicotiana tabacum] Length = 576 Score = 56.2 bits (134), Expect(2) = 4e-10 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVKT 169 PDGGTAKV +SCS + Q EQVTT+IRSMHK VKT Sbjct: 538 PDGGTAKVLLSSCSSEDQIEQVTTVIRSMHKNVKT 572 Score = 37.4 bits (85), Expect(2) = 4e-10 Identities = 16/22 (72%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 YS+KKQY +CLEIFEEM+ GC Sbjct: 515 YSKKKQYQRCLEIFEEMIDEGC 536 >ref|XP_016451478.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130-like [Nicotiana tabacum] ref|XP_018624137.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 [Nicotiana tomentosiformis] Length = 576 Score = 56.2 bits (134), Expect(2) = 4e-10 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVKT 169 PDGGTAKV +SCS + Q EQVTT+IRSMHK VKT Sbjct: 538 PDGGTAKVLLSSCSSEDQIEQVTTVIRSMHKNVKT 572 Score = 37.4 bits (85), Expect(2) = 4e-10 Identities = 16/22 (72%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 YS+KKQY +CLEIFEEM+ GC Sbjct: 515 YSKKKQYQRCLEIFEEMIDEGC 536 >ref|XP_006365038.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 isoform X2 [Solanum tuberosum] Length = 576 Score = 56.2 bits (134), Expect(2) = 4e-10 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVKT 169 PDGGTAKV +SCS + Q EQVTT+IRSMHK VKT Sbjct: 538 PDGGTAKVLLSSCSSEDQIEQVTTVIRSMHKNVKT 572 Score = 37.4 bits (85), Expect(2) = 4e-10 Identities = 16/22 (72%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 YS+KKQY +CLEIFEEM+ GC Sbjct: 515 YSKKKQYQRCLEIFEEMIDEGC 536 >ref|XP_004233239.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 [Solanum lycopersicum] Length = 576 Score = 56.2 bits (134), Expect(2) = 4e-10 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVKT 169 PDGGTAKV +SCS + Q EQVTT+IRSMHK VKT Sbjct: 538 PDGGTAKVLLSSCSSEDQIEQVTTVIRSMHKNVKT 572 Score = 37.4 bits (85), Expect(2) = 4e-10 Identities = 16/22 (72%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 YS+KKQY +CLEIFEEM+ GC Sbjct: 515 YSKKKQYQRCLEIFEEMIDEGC 536 >gb|PHT89812.1| Pentatricopeptide repeat-containing protein, partial [Capsicum annuum] Length = 575 Score = 56.2 bits (134), Expect(2) = 4e-10 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVKT 169 PDGGTAKV +SCS + Q EQVTT+IRSMHK VKT Sbjct: 537 PDGGTAKVLLSSCSSEDQIEQVTTVIRSMHKNVKT 571 Score = 37.4 bits (85), Expect(2) = 4e-10 Identities = 16/22 (72%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 YS+KKQY +CLEIFEEM+ GC Sbjct: 514 YSKKKQYQRCLEIFEEMIDEGC 535 >ref|XP_009792924.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 isoform X2 [Nicotiana sylvestris] ref|XP_009792925.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 isoform X2 [Nicotiana sylvestris] ref|XP_016503041.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130-like isoform X2 [Nicotiana tabacum] ref|XP_016503042.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130-like isoform X2 [Nicotiana tabacum] Length = 550 Score = 56.2 bits (134), Expect(2) = 4e-10 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVKT 169 PDGGTAKV +SCS + Q EQVTT+IRSMHK VKT Sbjct: 512 PDGGTAKVLLSSCSSEDQIEQVTTVIRSMHKNVKT 546 Score = 37.4 bits (85), Expect(2) = 4e-10 Identities = 16/22 (72%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 YS+KKQY +CLEIFEEM+ GC Sbjct: 489 YSKKKQYQRCLEIFEEMIDEGC 510 >gb|PHU25678.1| Pentatricopeptide repeat-containing protein, partial [Capsicum chinense] Length = 540 Score = 56.2 bits (134), Expect(2) = 4e-10 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVKT 169 PDGGTAKV +SCS + Q EQVTT+IRSMHK VKT Sbjct: 502 PDGGTAKVLLSSCSSEDQIEQVTTVIRSMHKNVKT 536 Score = 37.4 bits (85), Expect(2) = 4e-10 Identities = 16/22 (72%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 YS+KKQY +CLEIFEEM+ GC Sbjct: 479 YSKKKQYQRCLEIFEEMIDEGC 500 >ref|XP_018684405.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 [Musa acuminata subsp. malaccensis] Length = 613 Score = 55.5 bits (132), Expect(2) = 9e-10 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVK 166 PDGGTAKV ASC+ D+Q EQVTT+IRSMHKE + Sbjct: 575 PDGGTAKVLLASCTTDEQIEQVTTVIRSMHKEAR 608 Score = 37.0 bits (84), Expect(2) = 9e-10 Identities = 16/22 (72%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 Y+RKKQY +CLEIFEEM+ GC Sbjct: 552 YARKKQYKRCLEIFEEMIDAGC 573 >gb|KRG90712.1| hypothetical protein GLYMA_20G109800 [Glycine max] Length = 625 Score = 55.1 bits (131), Expect(2) = 2e-09 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVKT 169 PDGGTAKV A+CS + Q EQVTT+IR+MHK++KT Sbjct: 587 PDGGTAKVLLAACSNEDQTEQVTTVIRTMHKDMKT 621 Score = 36.6 bits (83), Expect(2) = 2e-09 Identities = 16/22 (72%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 YS+KK Y+KCLEIFEEM+ GC Sbjct: 564 YSKKKLYLKCLEIFEEMIDDGC 585 >ref|XP_003555869.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 isoform X1 [Glycine max] Length = 576 Score = 55.1 bits (131), Expect(2) = 2e-09 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVKT 169 PDGGTAKV A+CS + Q EQVTT+IR+MHK++KT Sbjct: 538 PDGGTAKVLLAACSNEDQTEQVTTVIRTMHKDMKT 572 Score = 36.6 bits (83), Expect(2) = 2e-09 Identities = 16/22 (72%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 YS+KK Y+KCLEIFEEM+ GC Sbjct: 515 YSKKKLYLKCLEIFEEMIDDGC 536 >gb|PHT55338.1| Pentatricopeptide repeat-containing protein, partial [Capsicum baccatum] Length = 575 Score = 54.3 bits (129), Expect(2) = 2e-09 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVK 166 PDGGTAKV +SCS + Q EQVTT+IRSMHK VK Sbjct: 537 PDGGTAKVLLSSCSSEDQIEQVTTVIRSMHKNVK 570 Score = 37.4 bits (85), Expect(2) = 2e-09 Identities = 16/22 (72%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 YS+KKQY +CLEIFEEM+ GC Sbjct: 514 YSKKKQYQRCLEIFEEMIDEGC 535 >ref|XP_006605878.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 isoform X2 [Glycine max] gb|KHN11471.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 558 Score = 55.1 bits (131), Expect(2) = 2e-09 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVKT 169 PDGGTAKV A+CS + Q EQVTT+IR+MHK++KT Sbjct: 520 PDGGTAKVLLAACSNEDQTEQVTTVIRTMHKDMKT 554 Score = 36.6 bits (83), Expect(2) = 2e-09 Identities = 16/22 (72%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 YS+KK Y+KCLEIFEEM+ GC Sbjct: 497 YSKKKLYLKCLEIFEEMIDDGC 518 >ref|XP_020244921.1| pentatricopeptide repeat-containing protein At2g35130 [Asparagus officinalis] Length = 579 Score = 55.1 bits (131), Expect(2) = 2e-09 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 65 PDGGTAKVPQASCSKDQQAEQVTTIIRSMHKEVK 166 PDGGTAKV ASC ++Q EQV+TI+RSMHKEVK Sbjct: 541 PDGGTAKVLLASCDSEEQIEQVSTIVRSMHKEVK 574 Score = 36.2 bits (82), Expect(2) = 2e-09 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = +1 Query: 1 YSRKKQYMKCLEIFEEMV-PGC 63 YSRKK Y+KCLEI EEMV GC Sbjct: 518 YSRKKMYVKCLEILEEMVDAGC 539