BLASTX nr result
ID: Ophiopogon24_contig00022248
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00022248 (495 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020276345.1| serine/threonine-protein kinase TIO [Asparag... 57 3e-06 >ref|XP_020276345.1| serine/threonine-protein kinase TIO [Asparagus officinalis] gb|ONK63237.1| uncharacterized protein A4U43_C07F12800 [Asparagus officinalis] Length = 1350 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 138 MGIENYHAIELDGEGSFGKVCKGRHKYTGK 49 MGIENYH IEL GEGSFGKV KGR KYTGK Sbjct: 1 MGIENYHVIELVGEGSFGKVYKGRRKYTGK 30