BLASTX nr result
ID: Ophiopogon24_contig00022231
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00022231 (430 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265501.1| calmodulin-binding protein 60 A-like isoform... 58 5e-07 ref|XP_020265500.1| calmodulin-binding protein 60 A-like isoform... 58 5e-07 >ref|XP_020265501.1| calmodulin-binding protein 60 A-like isoform X2 [Asparagus officinalis] gb|ONK70242.1| uncharacterized protein A4U43_C05F31720 [Asparagus officinalis] Length = 545 Score = 58.2 bits (139), Expect = 5e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 430 KANTVWGTLVSLFRWKLSIKRIVATKRRVRLKEIF 326 KANTVWGTLVS+ RW+ SIK+IVA KRRV KEIF Sbjct: 510 KANTVWGTLVSVLRWRCSIKKIVAMKRRVHQKEIF 544 >ref|XP_020265500.1| calmodulin-binding protein 60 A-like isoform X1 [Asparagus officinalis] Length = 556 Score = 58.2 bits (139), Expect = 5e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 430 KANTVWGTLVSLFRWKLSIKRIVATKRRVRLKEIF 326 KANTVWGTLVS+ RW+ SIK+IVA KRRV KEIF Sbjct: 521 KANTVWGTLVSVLRWRCSIKKIVAMKRRVHQKEIF 555